dbacp01200
General Description
Peptide name : ATAP-iRGD-M8
Source/Organism : Anti apoptotic (MCL-1, BFL1)
Linear/Cyclic : Linear
Chirality : L
Sequence Information
Sequence : KKFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC
Peptide length: 38
C-terminal modification: Linear
N-terminal modification : Not found
Non-natural peptide information: None
Activity Information
Assay type : MTT assay
Assay time : 48h
Activity : IC50 : 2.1 μM
Cell line : DU-145
Cancer type : Prostate cancer
Other activity : Not found
Physicochemical Properties
Amino acid composition bar chart :
Molecular mass : 4336.0842 Dalton
Aliphatic index : 0.615
Instability index : 11.1526
Hydrophobicity (GRAVY) : -0.494
Isoelectric point : 8.7299
Charge (pH 7) : 1.744
Aromaticity : 0.105
Molar extinction coefficient (cysteine, cystine): (6990, 7115)
Hydrophobic/hydrophilic ratio : 1.11111111
hydrophobic moment : 0.3302
Missing amino acid : N,H
Most occurring amino acid : K
Most occurring amino acid frequency : 6
Least occurring amino acid : W
Least occurring amino acid frequency : 1
Structural Information
3D structure :
Secondary structure fraction (Helix, Turn, Sheet): (0.4, 0.2, 0.3)
SMILES Notation: CC[C@H](C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)[C@H](CCSC)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCC(=O)O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CCCCN)[C@@H](C)O)C(C)C)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CS)C(=O)O
Secondary Structure :
| Method | Prediction |
|---|---|
| GOR | HHHCTTTTHHHHHHHHHHHHHHHHHHHHHETTTTCCCC |
| Chou-Fasman (CF) | CCCCCCEEEECCEEEEHHHHHHHHHHEEECCCCCCCCC |
| Neural Network (NN) | CCCCCCCCCEEEEHHCHHHHHHHHHHHHCCCCCCCCCC |
| Joint/Consensus | CCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCC |
Molecular Descriptors and ADMET Properties
Molecular Descriptors: Click here to download
ADMET Properties: Click here to download
Cross Referencing databases
Reference
1 : De G, et al. Amphipathic tail-anchoring peptide is a promising therapeutic agent for prostate cancer treatment. Oncotarget. 2014; 5:7734-47. doi: 10.18632/oncotarget.2301
Literature
Paper title : Amphipathic tail-anchoring peptide is a promising therapeutic agent for prostate cancer treatment.
Doi : https://doi.org/10.18632/oncotarget.2301
Abstract : Amphipathic tail-anchoring peptide (ATAP) derived from the human anti-apoptotic protein Bfl-1 is a potent inducer of apoptosis by targeting mitochondria permeability transition. By linking ATAP to an internalizing RGD peptide (iRGD), selective targeting for ATAP to tumor cell was achieved. Confocal fluorescence microscopy showed that ATAP-iRGD could penetrate into cancer cells and distribute along the mitochondria network. ATAP-iRGD triggered mitochondria-dependent cell death through release of cytochrome c. In an effort to promote ATAP-iRGD physiochemical properties to approach clinic application, amino acid substitution and chemical modification were made with ATAP-iRGD to improve its bioactivity. One of these modified peptides, ATAP-iRGD-M8, was with improved stability and aqueous solubility without compromising in vitro cytotoxicity in cultured cancer cells. In vivo xenograft studies with multiple prostate cancer cell lines showed that intravenous administration of ATAP-iRGD-M8 suppressed tumor growth. Toxicological studies revealed that repetitive intravenous administration of ATAP-iRGD-M8 did not produce significant toxicity in the SV129 mice. Our data suggest that ATAP-iRGD-M8 is a promising agent with high selectivity and limited systemic toxicity for prostate cancer treatment.