dbacp01842
General Description
Peptide name : BjarLAAO,L-amino-acid oxidase (BjarLAAO-I; LAAO; LAO; Snakes, reptils, animals)
Source/Organism : Venom base
Linear/Cyclic : Linear
Chirality : L
Sequence Information
Sequence : ADDKNPLEECFRETDYEEFLEIARNGLKATSNPKRVV
Peptide length: 37
C-terminal modification: Linear
N-terminal modification : Not found
Non-natural peptide information: None
Activity Information
Assay type : Not specified
Assay time : Not found
Activity : Not found
Cell line : EAT
Cancer type : Gastric cancer
Other activity : Not found
Physicochemical Properties
Amino acid composition bar chart :
Molecular mass : 4298.6999 Dalton
Aliphatic index : 0.659
Instability index : 42.0378
Hydrophobicity (GRAVY) : -0.986
Isoelectric point : 4.6491
Charge (pH 7) : -3.1978
Aromaticity : 0.081
Molar extinction coefficient (cysteine, cystine): (1490, 1490)
Hydrophobic/hydrophilic ratio : 0.68181818
hydrophobic moment : 0.5082
Missing amino acid : H,Q,W,M
Most occurring amino acid : E
Most occurring amino acid frequency : 6
Least occurring amino acid : C
Least occurring amino acid frequency : 1
Structural Information
3D structure :
Secondary structure fraction (Helix, Turn, Sheet): (0.4, 0.2, 0.3)
SMILES Notation: CC[C@H](C)[C@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CS)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](C)N)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)N[C@H](C(=O)O)C(C)C)C(C)C)[C@@H](C)O
Secondary Structure :
| Method | Prediction |
|---|---|
| GOR | CCTTCTHHHHHHTTHHHHHHHHHHHTHHCCCCTTEEE |
| Chou-Fasman (CF) | CCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC |
| Neural Network (NN) | CCCCCCCCHHCCCCCCHHHHHHHHHCCCCCCCCCCEE |
| Joint/Consensus | CCCCCCHHHHHHCCHHHHHHHHHHHCCCCCCCCCCEE |
Molecular Descriptors and ADMET Properties
Molecular Descriptors: Click here to download
ADMET Properties: Click here to download
Cross Referencing databases
Reference
1 : (None). RETRACTION: miR-664a-3p functions as an oncogene by targeting Hippo pathway in the development of gastric cancer. Cell Prolif. 2024; 57:e13681. doi: 10.1111/cpr.13681
Literature
Paper title : RETRACTION: miR-664a-3p functions as an oncogene by targeting Hippo pathway in the development of gastric cancer.
Doi : https://doi.org/10.1111/cpr.13681
Abstract : L. Wang, B. Li, L. Zhang, Q. Li, Z. He, X. Zhang, X. Huang, Z. Xu, Y. Xia, Q. Zhang, Q. Li, J. Xu, G. Sun, Z. Xu, "miR-664a-3p functions as an oncogene by targeting Hippo pathway in the development of gastric cancer," Cell Proliferation 52, no. 3 (2019): e12567, https://doi.org/10.1111/cpr.12567. The above article, published online on 18 March 2019, in Wiley Online Library (wileyonlinelibrary.com), has been retracted by agreement between the journal Editor-in-Chief, Qi Zhou, and John Wiley and Sons Ltd. Following publication, concerns were raised by third parties regarding suspected duplication of figures 2c, 2d, 4g, 4h and 5a. The authors explained that the duplicates were a result of negligence during data storage. Due to the extent and nature of the mistakes made, the editors have lost confidence in the results and conclusions of this study.