dbACP: A Comprehensive Database of Anti-Cancer Peptides

dbacp01842

General Description

Peptide name : BjarLAAO,L-amino-acid oxidase (BjarLAAO-I; LAAO; LAO; Snakes, reptils, animals)

Source/Organism : Venom base

Linear/Cyclic : Linear

Chirality : L

Sequence Information

Sequence : ADDKNPLEECFRETDYEEFLEIARNGLKATSNPKRVV

Peptide length: 37

C-terminal modification: Linear

N-terminal modification : Not found

Non-natural peptide information: None

Activity Information

Assay type : Not specified

Assay time : Not found

Activity : Not found

Cell line : EAT

Cancer type : Gastric cancer

Other activity : Not found

Physicochemical Properties

Amino acid composition bar chart :

Molecular mass : 4298.6999 Dalton

Aliphatic index : 0.659

Instability index : 42.0378

Hydrophobicity (GRAVY) : -0.986

Isoelectric point : 4.6491

Charge (pH 7) : -3.1978

Aromaticity : 0.081

Molar extinction coefficient (cysteine, cystine): (1490, 1490)

Hydrophobic/hydrophilic ratio : 0.68181818

hydrophobic moment : 0.5082

Missing amino acid : H,Q,W,M

Most occurring amino acid : E

Most occurring amino acid frequency : 6

Least occurring amino acid : C

Least occurring amino acid frequency : 1

Structural Information

3D structure :

Secondary structure fraction (Helix, Turn, Sheet): (0.4, 0.2, 0.3)

SMILES Notation: CC[C@H](C)[C@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CS)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](C)N)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)N[C@H](C(=O)O)C(C)C)C(C)C)[C@@H](C)O

Secondary Structure :

Method Prediction
GOR CCTTCTHHHHHHTTHHHHHHHHHHHTHHCCCCTTEEE
Chou-Fasman (CF) CCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC
Neural Network (NN) CCCCCCCCHHCCCCCCHHHHHHHHHCCCCCCCCCCEE
Joint/Consensus CCCCCCHHHHHHCCHHHHHHHHHHHCCCCCCCCCCEE

Molecular Descriptors and ADMET Properties

Molecular Descriptors: Click here to download

ADMET Properties: Click here to download

Cross Referencing databases

Pubmed Id : 38804819

Uniprot : Not available

PDB : Not available

CancerPPD : Not available

ApIAPDB : Click Here

CancerPPD2 ID : Not available

Reference

1 : (None). RETRACTION: miR-664a-3p functions as an oncogene by targeting Hippo pathway in the development of gastric cancer. Cell Prolif. 2024; 57:e13681. doi: 10.1111/cpr.13681

Literature

Paper title : RETRACTION: miR-664a-3p functions as an oncogene by targeting Hippo pathway in the development of gastric cancer.

Doi : https://doi.org/10.1111/cpr.13681

Abstract : L. Wang, B. Li, L. Zhang, Q. Li, Z. He, X. Zhang, X. Huang, Z. Xu, Y. Xia, Q. Zhang, Q. Li, J. Xu, G. Sun, Z. Xu, "miR-664a-3p functions as an oncogene by targeting Hippo pathway in the development of gastric cancer," Cell Proliferation 52, no. 3 (2019): e12567, https://doi.org/10.1111/cpr.12567. The above article, published online on 18 March 2019, in Wiley Online Library (wileyonlinelibrary.com), has been retracted by agreement between the journal Editor-in-Chief, Qi Zhou, and John Wiley and Sons Ltd. Following publication, concerns were raised by third parties regarding suspected duplication of figures 2c, 2d, 4g, 4h and 5a. The authors explained that the duplicates were a result of negligence during data storage. Due to the extent and nature of the mistakes made, the editors have lost confidence in the results and conclusions of this study.