dbACP: A Comprehensive Database of Anti-Cancer Peptides

dbacp02321

General Description

Peptide name : CB

Source/Organism : Synthetic

Linear/Cyclic : Linear

Chirality : L

Sequence Information

Sequence : KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL

Peptide length: 35

C-terminal modification: Linear

N-terminal modification : Free

Non-natural peptide information: None

Activity Information

Assay type : Not specified

Assay time : Not found

Activity : Not found

Cell line : Ags

Cancer type : Gastric cancer

Other activity : Anti-microbial activity

Physicochemical Properties

Amino acid composition bar chart :

Molecular mass : 3835.6542 Dalton

Aliphatic index : 1.06

Instability index : 35.4229

Hydrophobicity (GRAVY) : -0.071

Isoelectric point : 10.729

Charge (pH 7) : 6.7587

Aromaticity : 0.057

Molar extinction coefficient (cysteine, cystine): (5500, 5500)

Hydrophobic/hydrophilic ratio : 1.69230769

hydrophobic moment : 0.8502

Missing amino acid : C,H,Q,T,S,D,Y

Most occurring amino acid : K

Most occurring amino acid frequency : 7

Least occurring amino acid : W

Least occurring amino acid frequency : 1

Structural Information

3D structure :

Secondary structure fraction (Helix, Turn, Sheet): (0.4, 0.2, 0.3)

SMILES Notation: CC[C@H](C)[C@H](NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)[C@H](CCSC)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@@H](N)CCCCN)C(C)C)[C@@H](C)CC)[C@@H](C)CC)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)O)C(C)C)[C@@H](C)CC)C(C)C

Secondary Structure :

Method Prediction
GOR HHHHHHHHHHHHHHHHTCEEECCCHHHHHHHHHHH
Chou-Fasman (CF) CCHHHHHHHHCEECEEEEECCCCCEEEHHHHHCCC
Neural Network (NN) HHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHH
Joint/Consensus HHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHH

Molecular Descriptors and ADMET Properties

Molecular Descriptors: Click here to download

ADMET Properties: Click here to download

Cross Referencing databases

Pubmed Id : 15496597

Uniprot : Not available

PDB : Not available

CancerPPD : Click here

ApIAPDB : Not available

CancerPPD2 ID : Not available

Reference

1 : Ye JS, et al. Induction of transient ion channel-like pores in a cancer cell by antibiotic peptide. J Biochem. 2004; 136:255-9. doi: 10.1093/jb/mvh114

Literature

Paper title : Induction of transient ion channel-like pores in a cancer cell by antibiotic peptide.

Doi : https://doi.org/10.1093/jb/mvh114

Abstract : The anticancer activity of anti-bacterial cecropins makes them potentially useful as peptide anti-cancer drugs. We used the cell-attached patch to study the effect of cecropin B (CB; having one hydrophobic and one amphipathic alpha-helix) and its derivative, cecropin B3 (CB3; having two hydrophobic alpha-helices) on the membrane of Ags cancer cells. Application of 10-60 microM CB onto the membrane of the cancer cell produces short outward currents. Comparative study with CB3, which induces no outward currents, shows that the amphipathic group of CB is necessary for the pore formation. The results provide a rationale to study the cell-killing activity of antimicrobial peptides at the single cancer cell level.