dbacp02332
General Description
Peptide name : Cecropin A
Source/Organism : Silkmoth
Linear/Cyclic : Linear
Chirality : L
Sequence Information
Sequence : KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK
Peptide length: 37
C-terminal modification: Linear
N-terminal modification : Amidation
Non-natural peptide information: None
Activity Information
Assay type : Cell viability assay
Assay time : 48h
Activity : IC50 : 28.74 µg/ml
Cell line : 647V
Cancer type : Bladder cancer
Other activity : Not found
Physicochemical Properties
Amino acid composition bar chart :
Molecular mass : 4004.7658 Dalton
Aliphatic index : 1.081
Instability index : 16.5243
Hydrophobicity (GRAVY) : -0.073
Isoelectric point : 10.391
Charge (pH 7) : 5.757
Aromaticity : 0.054
Molar extinction coefficient (cysteine, cystine): (5500, 5500)
Hydrophobic/hydrophilic ratio : 1.46666666
hydrophobic moment : 0.652
Missing amino acid : C,H,M,S,Y
Most occurring amino acid : K
Most occurring amino acid frequency : 7
Least occurring amino acid : W
Least occurring amino acid frequency : 1
Structural Information
3D structure :
Secondary structure fraction (Helix, Turn, Sheet): (0.3, 0.1, 0.3)
SMILES Notation: CC[C@H](C)[C@H](NC(=O)CNC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@@H](N)CCCCN)[C@@H](C)CC)C(C)C)[C@@H](C)CC)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)O)[C@@H](C)CC)[C@@H](C)O)C(C)C)C(C)C)C(C)C)[C@@H](C)CC
Secondary Structure :
| Method | Prediction |
|---|---|
| GOR | HHHHHHHHHHHTCCHEEEEEECCCHEEEEHHHHHHHH |
| Chou-Fasman (CF) | HHHHHHHHHEEEECEEEEECCCCCEEEEECCEECCCC |
| Neural Network (NN) | HHHHHHHHHCCCCCCCCCCECCCCCEEHHHHHHHHHH |
| Joint/Consensus | HHHHHHHHHCCCCCCEEEEECCCCCEEEEHHHHHHHH |
Molecular Descriptors and ADMET Properties
Molecular Descriptors: Click here to download
ADMET Properties: Click here to download
Cross Referencing databases
Reference
1 : Suttmann H, et al. Antimicrobial peptides of the Cecropin-family show potent antitumor activity against bladder cancer cells. BMC Urol. 2008; 8:5. doi: 10.1186/1471-2490-8-5
Literature
Paper title : Antimicrobial peptides of the Cecropin-family show potent antitumor activity against bladder cancer cells.
Doi : https://doi.org/10.1186/1471-2490-8-5
Abstract : BACKGROUND: This study evaluated the cytotoxic and antiproliferative efficacy of two well-characterized members of the Cecropin-family of antimicrobial peptides against bladder tumor cells and benign fibroblasts. METHODS: The antiproliferative and cytotoxic potential of the Cecropins A and B was quantified by colorimetric WST-1-, BrdU- and LDH-assays in four bladder cancer cell lines as well as in murine and human fibroblast cell lines. IC50 values were assessed by logarithmic extrapolation, representing the concentration at which cell viability was reduced by 50%. Scanning electron microscopy (SEM) was performed to visualize the morphological changes induced by Cecropin A and B in bladder tumor cells and fibroblasts. RESULTS: Cecropin A and B inhibit bladder cancer cell proliferation and viability in a dose-dependent fashion. The average IC50 values of Cecropin A and B against all bladder cancer cell lines ranged between 73.29 mug/ml and 220.05 mug/ml. In contrast, benign fibroblasts were significantly less or not at all susceptible to Cecropin A and B. Both Cecropins induced an increase in LDH release from bladder tumor cells whereas benign fibroblasts were not affected. SEM demonstrated lethal membrane disruption in bladder cancer cells as opposed to fibroblasts. CONCLUSION: Cecropin A and B exert selective cytotoxic and antiproliferative efficacy in bladder cancer cells while sparing targets of benign murine or human fibroblast origin. Both peptides may offer novel therapeutic strategies for the treatment of bladder cancer with limited cytotoxic effects on benign cells.