dbACP: A Comprehensive Database of Anti-Cancer Peptides

dbacp02339

General Description

Peptide name : Cecropin A

Source/Organism : Isolated from the giant silk moth, cecropia moth

Linear/Cyclic : Linear

Chirality : L

Sequence Information

Sequence : KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK

Peptide length: 37

C-terminal modification: Linear

N-terminal modification : Free

Non-natural peptide information: None

Activity Information

Assay type : MTT/MTS assay

Assay time : 48h

Activity : IC50 : 2.2 µM

Cell line : SCC25

Cancer type : Skin cancer

Other activity : Anti-microbial activity

Physicochemical Properties

Amino acid composition bar chart :

Molecular mass : 4004.7658 Dalton

Aliphatic index : 1.081

Instability index : 16.5243

Hydrophobicity (GRAVY) : -0.073

Isoelectric point : 10.391

Charge (pH 7) : 5.757

Aromaticity : 0.054

Molar extinction coefficient (cysteine, cystine): (5500, 5500)

Hydrophobic/hydrophilic ratio : 1.46666666

hydrophobic moment : 0.652

Missing amino acid : C,H,M,S,Y

Most occurring amino acid : K

Most occurring amino acid frequency : 7

Least occurring amino acid : W

Least occurring amino acid frequency : 1

Structural Information

3D structure :

Secondary structure fraction (Helix, Turn, Sheet): (0.3, 0.1, 0.3)

SMILES Notation: CC[C@H](C)[C@H](NC(=O)CNC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@@H](N)CCCCN)[C@@H](C)CC)C(C)C)[C@@H](C)CC)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)O)[C@@H](C)CC)[C@@H](C)O)C(C)C)C(C)C)C(C)C)[C@@H](C)CC

Secondary Structure :

Method Prediction
GOR HHHHHHHHHHHTCCHEEEEEECCCHEEEEHHHHHHHH
Chou-Fasman (CF) HHHHHHHHHEEEECEEEEECCCCCEEEEECCEECCCC
Neural Network (NN) HHHHHHHHHCCCCCCCCCCECCCCCEEHHHHHHHHHH
Joint/Consensus HHHHHHHHHCCCCCCEEEEECCCCCEEEEHHHHHHHH

Molecular Descriptors and ADMET Properties

Molecular Descriptors: Click here to download

ADMET Properties: Click here to download

Cross Referencing databases

Pubmed Id : 24661024

Uniprot : Not available

PDB : Not available

CancerPPD : Click here

ApIAPDB : Not available

CancerPPD2 ID : Not available

Reference

1 : Do N, et al. Cationic membrane-active peptides - anticancer and antifungal activity as well as penetration into human skin. Exp Dermatol. 2014; 23:326-31. doi: 10.1111/exd.12384

Literature

Paper title : Cationic membrane-active peptides - anticancer and antifungal activity as well as penetration into human skin.

Doi : https://doi.org/10.1111/exd.12384

Abstract : Cationic antimicrobial peptides are ancient natural broad-spectrum antibiotics, and several compounds also exhibit anticancer activity. However, most applications pertain to bacterial infections, and treatment for skin cancer is less frequently considered. The cytotoxicity of melittin, cecropin A, protegrin-1 and histatin 5 against squamous skin cancer cell lines and normal human keratinocytes was evaluated and compared to established drugs. The results show that melittin clearly outperforms 5-fluorouracil regarding antitumor activity. Importantly, combined melittin and 5-fluorouracil enhanced cytotoxic effects on cancer cells and reduced toxicity on normal keratinocytes. Additionally, minimum inhibitory concentrations indicate that melittin also shows superior activity against clinical and laboratory strains of Candida albicans compared to amphotericin B. To evaluate its potential for topical applications, human skin penetration of melittin was investigated ex vivo and compared to two non-toxic cell-penetrating peptides (CPPs), low molecular weight protamine (LMWP) and penetratin. The stratum corneum prevents penetration into viable epidermis over 6 h; however, the peptides gain access to the viable skin after 24 h. Inhibition of digestive enzymes during skin penetration significantly enhances the availability of intact peptide. In conclusion, melittin may represent an innovative agent for non-melanoma skin cancer and infectious skin diseases. In order to develop a drug candidate, skin absorption and proteolytic digestion by skin enzymes need to be addressed.