dbacp02359
General Description
Peptide name : Cecropin B
Source/Organism : Silkmoth
Linear/Cyclic : Linear
Chirality : L
Sequence Information
Sequence : KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL
Peptide length: 35
C-terminal modification: Linear
N-terminal modification : Amidation
Non-natural peptide information: None
Activity Information
Assay type : MTT/MTS assay
Assay time : 96h
Activity : IC50 : 25.5 µM
Cell line : HRT-18
Cancer type : Colon cancer
Other activity : Anti-microbial activity
Physicochemical Properties
Amino acid composition bar chart :
Molecular mass : 3835.6542 Dalton
Aliphatic index : 1.06
Instability index : 35.4229
Hydrophobicity (GRAVY) : -0.071
Isoelectric point : 10.729
Charge (pH 7) : 6.7587
Aromaticity : 0.057
Molar extinction coefficient (cysteine, cystine): (5500, 5500)
Hydrophobic/hydrophilic ratio : 1.69230769
hydrophobic moment : 0.8502
Missing amino acid : C,H,Q,T,S,D,Y
Most occurring amino acid : K
Most occurring amino acid frequency : 7
Least occurring amino acid : W
Least occurring amino acid frequency : 1
Structural Information
3D structure :
Secondary structure fraction (Helix, Turn, Sheet): (0.4, 0.2, 0.3)
SMILES Notation: CC[C@H](C)[C@H](NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)[C@H](CCSC)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@@H](N)CCCCN)C(C)C)[C@@H](C)CC)[C@@H](C)CC)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)O)C(C)C)[C@@H](C)CC)C(C)C
Secondary Structure :
| Method | Prediction |
|---|---|
| GOR | HHHHHHHHHHHHHHHHTCEEECCCHHHHHHHHHHH |
| Chou-Fasman (CF) | CCHHHHHHHHCEECEEEEECCCCCEEEHHHHHCCC |
| Neural Network (NN) | HHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHH |
| Joint/Consensus | HHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHH |
Molecular Descriptors and ADMET Properties
Molecular Descriptors: Click here to download
ADMET Properties: Click here to download
Cross Referencing databases
Reference
1 : Moore AJ, et al. Preliminary experimental anticancer activity of cecropins. Pept Res. 1994; 7:265-9.
Literature
Paper title : Preliminary experimental anticancer activity of cecropins.
Doi : https://doi.org/Not available
Abstract : The cecropins are a group of peptides that were first isolated from the hemolymph of the giant silk moth, Hyalophora cecropia. In preliminary studies, these novel peptides were shown to be active against several bacteria and mammalian lymphomas and leukemias in vitro. The mechanism of action of the cecropins is thought to involve pore formation at the cytoplasmic membrane. The potential anticancer activity of cecropin B, cecropin P1 and Shiva-1 was investigated against a panel of mammalian cell lines in vitro. Cell lines showed a range of sensitivities to cecropin B (IC50 3.2 to > 100 microM), and two cell lines with the multidrug-resistant phenotype were sensitive to the peptide. In vitro cecropin B activity was virtually complete within one hour. Preliminary in vivo studies showed that cecropin B increases the survival time of mice bearing murine ascitic colon adenocarcinoma cells. Future studies will address structure/activity relationships of similar peptides in order to optimize antitumor activity.