dbACP: A Comprehensive Database of Anti-Cancer Peptides

dbacp02361

General Description

Peptide name : Cecropin B

Source/Organism : Silkmoth

Linear/Cyclic : Linear

Chirality : L

Sequence Information

Sequence : KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL

Peptide length: 35

C-terminal modification: Linear

N-terminal modification : Amidation

Non-natural peptide information: None

Activity Information

Assay type : MTT/MTS assay

Assay time : 96h

Activity : IC50 : 4.4 µM

Cell line : WEHI-3B

Cancer type : Leukemia cancer

Other activity : Anti-microbial activity

Physicochemical Properties

Amino acid composition bar chart :

Molecular mass : 3835.6542 Dalton

Aliphatic index : 1.06

Instability index : 35.4229

Hydrophobicity (GRAVY) : -0.071

Isoelectric point : 10.729

Charge (pH 7) : 6.7587

Aromaticity : 0.057

Molar extinction coefficient (cysteine, cystine): (5500, 5500)

Hydrophobic/hydrophilic ratio : 1.69230769

hydrophobic moment : 0.8502

Missing amino acid : C,H,Q,T,S,D,Y

Most occurring amino acid : K

Most occurring amino acid frequency : 7

Least occurring amino acid : W

Least occurring amino acid frequency : 1

Structural Information

3D structure :

Secondary structure fraction (Helix, Turn, Sheet): (0.4, 0.2, 0.3)

SMILES Notation: CC[C@H](C)[C@H](NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)[C@H](CCSC)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@@H](N)CCCCN)C(C)C)[C@@H](C)CC)[C@@H](C)CC)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)O)C(C)C)[C@@H](C)CC)C(C)C

Secondary Structure :

Method Prediction
GOR HHHHHHHHHHHHHHHHTCEEECCCHHHHHHHHHHH
Chou-Fasman (CF) CCHHHHHHHHCEECEEEEECCCCCEEEHHHHHCCC
Neural Network (NN) HHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHH
Joint/Consensus HHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHH

Molecular Descriptors and ADMET Properties

Molecular Descriptors: Click here to download

ADMET Properties: Click here to download

Cross Referencing databases

Pubmed Id : 7849420

Uniprot : Not available

PDB : Not available

CancerPPD : Click here

ApIAPDB : Not available

CancerPPD2 ID : Not available

Reference

1 : Moore AJ, et al. Preliminary experimental anticancer activity of cecropins. Pept Res. 1994; 7:265-9.

Literature

Paper title : Preliminary experimental anticancer activity of cecropins.

Doi : https://doi.org/Not available

Abstract : The cecropins are a group of peptides that were first isolated from the hemolymph of the giant silk moth, Hyalophora cecropia. In preliminary studies, these novel peptides were shown to be active against several bacteria and mammalian lymphomas and leukemias in vitro. The mechanism of action of the cecropins is thought to involve pore formation at the cytoplasmic membrane. The potential anticancer activity of cecropin B, cecropin P1 and Shiva-1 was investigated against a panel of mammalian cell lines in vitro. Cell lines showed a range of sensitivities to cecropin B (IC50 3.2 to > 100 microM), and two cell lines with the multidrug-resistant phenotype were sensitive to the peptide. In vitro cecropin B activity was virtually complete within one hour. Preliminary in vivo studies showed that cecropin B increases the survival time of mice bearing murine ascitic colon adenocarcinoma cells. Future studies will address structure/activity relationships of similar peptides in order to optimize antitumor activity.