dbacp02530
General Description
Peptide name : Cliotide T7
Source/Organism : Butterfly pea
Linear/Cyclic : Not found
Chirality : L
Sequence Information
Sequence : GIPCGESCVFIPCTVTALLGCSCKDKVCYKN
Peptide length: 31
C-terminal modification: Not found
N-terminal modification : Free
Non-natural peptide information: None
Activity Information
Assay type : Not specified
Assay time : Not found
Activity : Not found
Cell line : Not found
Cancer type : Not found
Other activity : Anti-microbial activity
Physicochemical Properties
Amino acid composition bar chart :
Molecular mass : 3252.8886 Dalton
Aliphatic index : 0.816
Instability index : 24.8968
Hydrophobicity (GRAVY) : 0.5774
Isoelectric point : 7.7647
Charge (pH 7) : 0.7006
Aromaticity : 0.064
Molar extinction coefficient (cysteine, cystine): (1490, 1865)
Hydrophobic/hydrophilic ratio : 1.81818181
hydrophobic moment : 0.1259
Missing amino acid : R,W,H,Q,M
Most occurring amino acid : C
Most occurring amino acid frequency : 6
Least occurring amino acid : E
Least occurring amino acid frequency : 1
Structural Information
3D structure :
Secondary structure fraction (Helix, Turn, Sheet): (0.2, 0.2, 0.3)
SMILES Notation: CC[C@H](C)[C@H](NC(=O)CN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CS)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CS)C(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)O)C(C)C)[C@@H](C)O)C(C)C)[C@@H](C)O)[C@@H](C)CC)C(C)C
Secondary Structure :
| Method | Prediction |
|---|---|
| GOR | CCCTCCTEEECCCCECEEETCTTTTTHTTTT |
| Chou-Fasman (CF) | EECCCEEEEEEEEEECCEECCCCCCEECCCC |
| Neural Network (NN) | CCCCCCCCEEEECCEEEECCCCCCCCCCCCC |
| Joint/Consensus | CCCCCCCEEEEECCEEEEECCCCCCCCCCCC |
Molecular Descriptors and ADMET Properties
Molecular Descriptors: Click here to download
ADMET Properties: Click here to download
Cross Referencing databases
CancerPPD : Not available
ApIAPDB : Not available
CancerPPD2 ID : Not available
Reference
1 : Nguyen GK, et al. Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family. J Biol Chem. 2011; 286:24275-87. doi: 10.1074/jbc.M111.229922
Literature
Paper title : Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family.
Doi : https://doi.org/10.1074/jbc.M111.229922
Abstract : The tropical plant Clitoria ternatea is a member of the Fabaceae family well known for its medicinal values. Heat extraction of C. ternatea revealed that the bioactive fractions contained heat-stable cysteine-rich peptides (CRPs). The CRP family of A1b (Albumin-1 chain b/leginsulins), which is a linear cystine knot CRP, has been shown to present abundantly in the Fabaceae. In contrast, the cyclotide family, which also belongs to the cystine knot CRPs but with a cyclic structure, is commonly found in the Rubiaceae, Violaceae, and Cucurbitaceae families. In this study, we report the discovery of a panel of 15 heat-stable CRPs, of which 12 sequences (cliotide T1-T12) are novel. We show unambiguously that the cliotides are cyclotides and not A1bs, as determined by their sequence homology, disulfide connectivity, and membrane active properties indicated by their antimicrobial activities against Escherichia coli and cytotoxicities to HeLa cells. We also show that cliotides are prevalent in C. ternatea and are found in every plant tissue examined, including flowers, seeds, and nodules. In addition, we demonstrate that their precursors are chimeras, half from cyclotide and the other half from Albumin-1, with the cyclotide domain displacing the A1b domain in the precursor. Their chimeric structures likely originate from either horizontal gene transfer or convergent evolution in plant nuclear genomes, which are exceedingly rare events. Such atypical genetic arrangement also implies a different mechanism of biosynthetic processing of cyclotides in the Fabaceae and provides new understanding of their evolution in plants.