dbACP: A Comprehensive Database of Anti-Cancer Peptides

dbacp02531

General Description

Peptide name : CM4

Source/Organism : Hemolymph, Chinese silkworm

Linear/Cyclic : Not found

Chirality : Not found

Sequence Information

Sequence : RWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI

Peptide length: 35

C-terminal modification: Not found

N-terminal modification : Free

Non-natural peptide information: None

Activity Information

Assay type : Not specified

Assay time : Not found

Activity : Not found

Cell line : Not found

Cancer type : Not found

Other activity : Anti-fungal activity

Physicochemical Properties

Amino acid composition bar chart :

Molecular mass : 3762.4511 Dalton

Aliphatic index : 1.114

Instability index : 34.5943

Hydrophobicity (GRAVY) : 0.1286

Isoelectric point : 10.565

Charge (pH 7) : 4.759

Aromaticity : 0.057

Molar extinction coefficient (cysteine, cystine): (5500, 5500)

Hydrophobic/hydrophilic ratio : 1.69230769

hydrophobic moment : 0.8987

Missing amino acid : C,H,M,S,Y,L

Most occurring amino acid : K

Most occurring amino acid frequency : 5

Least occurring amino acid : W

Least occurring amino acid frequency : 1

Structural Information

3D structure :

Secondary structure fraction (Helix, Turn, Sheet): (0.3, 0.2, 0.3)

SMILES Notation: CC[C@H](C)[C@H](NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@@H](N)CCCNC(=N)N)[C@@H](C)CC)[C@@H](C)CC)C(C)C)[C@@H](C)CC)[C@@H](C)CC)C(C)C)C(C)C)C(C)C)C(C)C)[C@@H](C)O)C(=O)O

Secondary Structure :

Method Prediction
GOR HHHHHHHHHHHTCCHEEEEEECCCHEEEEEHHHEE
Chou-Fasman (CF) EEHHHHHHHEEEECEEEEECCCCCEEEEECCCCCC
Neural Network (NN) HHHHHCCCCCCCCCCCCCCECCCCCEEHHHCCCCH
Joint/Consensus HHHHHHHHHCCCCCCEEEEECCCCCEEEECCCCCC

Molecular Descriptors and ADMET Properties

Molecular Descriptors: Click here to download

ADMET Properties: Click here to download

Cross Referencing databases

Pubmed Id : 16342763

Uniprot : Not available

PDB : Not available

CancerPPD : Not available

ApIAPDB : Not available

CancerPPD2 ID : Not available

Reference

1 : Zhang J, et al. [Cloning, expression and characterization of antibacterial peptide CM4 in Pichia pastoris]. Wei Sheng Wu Xue Bao. 2005; 45:720-3.

Literature

Paper title : [Cloning, expression and characterization of antibacterial peptide CM4 in Pichia pastoris].

Doi : https://doi.org/Not available

Abstract : To explore a new approach of expression of ABP-CM4 in methylotrophic yeast P. pastoris. The gene of ABP-CM4 was cloned into the vector pPIC9. The Sac I -linearized plasmid pPIC9-CM4 was transformed into P. pastoris GS115 by electroporation. By means of MM and MD plates and PCR, the recombinant P. pastoris strains (his- mut+) were obtained. Antibacterial assay, Tricine-SDS-PAGE and Polyarylamide Gel Electrophoresis demonstrated that ABP-CM4 was extracellularly expressed in P. pastoris with the induction of methanol. The recombinant ABP-CM4 has the antifungal activity on Aspergillus niger and Trichoderma viride.