dbacp02531
General Description
Peptide name : CM4
Source/Organism : Hemolymph, Chinese silkworm
Linear/Cyclic : Not found
Chirality : Not found
Sequence Information
Sequence : RWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI
Peptide length: 35
C-terminal modification: Not found
N-terminal modification : Free
Non-natural peptide information: None
Activity Information
Assay type : Not specified
Assay time : Not found
Activity : Not found
Cell line : Not found
Cancer type : Not found
Other activity : Anti-fungal activity
Physicochemical Properties
Amino acid composition bar chart :
Molecular mass : 3762.4511 Dalton
Aliphatic index : 1.114
Instability index : 34.5943
Hydrophobicity (GRAVY) : 0.1286
Isoelectric point : 10.565
Charge (pH 7) : 4.759
Aromaticity : 0.057
Molar extinction coefficient (cysteine, cystine): (5500, 5500)
Hydrophobic/hydrophilic ratio : 1.69230769
hydrophobic moment : 0.8987
Missing amino acid : C,H,M,S,Y,L
Most occurring amino acid : K
Most occurring amino acid frequency : 5
Least occurring amino acid : W
Least occurring amino acid frequency : 1
Structural Information
3D structure :
Secondary structure fraction (Helix, Turn, Sheet): (0.3, 0.2, 0.3)
SMILES Notation: CC[C@H](C)[C@H](NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@@H](N)CCCNC(=N)N)[C@@H](C)CC)[C@@H](C)CC)C(C)C)[C@@H](C)CC)[C@@H](C)CC)C(C)C)C(C)C)C(C)C)C(C)C)[C@@H](C)O)C(=O)O
Secondary Structure :
| Method | Prediction |
|---|---|
| GOR | HHHHHHHHHHHTCCHEEEEEECCCHEEEEEHHHEE |
| Chou-Fasman (CF) | EEHHHHHHHEEEECEEEEECCCCCEEEEECCCCCC |
| Neural Network (NN) | HHHHHCCCCCCCCCCCCCCECCCCCEEHHHCCCCH |
| Joint/Consensus | HHHHHHHHHCCCCCCEEEEECCCCCEEEECCCCCC |
Molecular Descriptors and ADMET Properties
Molecular Descriptors: Click here to download
ADMET Properties: Click here to download
Cross Referencing databases
CancerPPD : Not available
ApIAPDB : Not available
CancerPPD2 ID : Not available
Reference
1 : Zhang J, et al. [Cloning, expression and characterization of antibacterial peptide CM4 in Pichia pastoris]. Wei Sheng Wu Xue Bao. 2005; 45:720-3.
Literature
Paper title : [Cloning, expression and characterization of antibacterial peptide CM4 in Pichia pastoris].
Doi : https://doi.org/Not available
Abstract : To explore a new approach of expression of ABP-CM4 in methylotrophic yeast P. pastoris. The gene of ABP-CM4 was cloned into the vector pPIC9. The Sac I -linearized plasmid pPIC9-CM4 was transformed into P. pastoris GS115 by electroporation. By means of MM and MD plates and PCR, the recombinant P. pastoris strains (his- mut+) were obtained. Antibacterial assay, Tricine-SDS-PAGE and Polyarylamide Gel Electrophoresis demonstrated that ABP-CM4 was extracellularly expressed in P. pastoris with the induction of methanol. The recombinant ABP-CM4 has the antifungal activity on Aspergillus niger and Trichoderma viride.