dbacp02938
General Description
Peptide name : Figainin 1
Source/Organism : Chaco tree frog
Linear/Cyclic : Not found
Chirality : Not found
Sequence Information
Sequence : MAFLKKSLFLVLFLGLVSLSIGEEEKREEEEKNEEGANQEENAENKEKRFIGTLIPLALGALTKLFKG
Peptide length: 68
C-terminal modification: Not found
N-terminal modification : Free
Non-natural peptide information: None
Activity Information
Assay type : MTT/MTS assay
Assay time : 24h
Activity : IC50 : 10.5 µM
Cell line : B16F10
Cancer type : Cervical cancer
Other activity : Anti-microbial activity; Hemolytic activity
Physicochemical Properties
Amino acid composition bar chart :
Molecular mass : 7639.7299 Dalton
Aliphatic index : 1.019
Instability index : 48.7868
Hydrophobicity (GRAVY) : -0.273
Isoelectric point : 4.9779
Charge (pH 7) : -3.4711
Aromaticity : 0.073
Molar extinction coefficient (cysteine, cystine): (0, 0)
Hydrophobic/hydrophilic ratio : 1.06060606
hydrophobic moment : 0.2768
Missing amino acid : C,W,H,D,Y
Most occurring amino acid : E
Most occurring amino acid frequency : 13
Least occurring amino acid : M
Least occurring amino acid frequency : 1
Structural Information
3D structure :
Secondary structure fraction (Helix, Turn, Sheet): (0.5, 0.2, 0.3)
SMILES Notation: CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](C)NC(=O)CNC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCSC)C(C)C)C(C)C)[C@@H](C)CC)C(=O)NCC(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)O)[C@@H](C)O)[C@@H](C)CC)[C@@H](C)O
Secondary Structure :
| Method | Prediction |
|---|---|
| GOR | HHHHHHHHHEEEEEEEEEETHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEECHHHHHHHHHHHTT |
| Chou-Fasman (CF) | HHHHHHEEEEEEEEEEEEECHHHHHHHHHHHHHHHCHHHHHHHHHHHEEEEEEEHHHHHCCCCCCCCC |
| Neural Network (NN) | HHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHCCC |
| Joint/Consensus | HHHHHHHHHEEEEEEEEEECHHHHHHHHHHHHHHHCHHHHHHHHHHHHHEEEEECHHHHHHHHHHCCC |
Molecular Descriptors and ADMET Properties
Molecular Descriptors: Click here to download
ADMET Properties: Click here to download
Cross Referencing databases
CancerPPD : Not available
ApIAPDB : Not available
CancerPPD2 ID : Not available
Reference
1 : Santana CJC, et al. Figainin 1, a Novel Amphibian Skin Peptide with Antimicrobial and Antiproliferative Properties. Antibiotics (Basel). 2020; 9:(unknown pages). doi: 10.3390/antibiotics9090625
Literature
Paper title : Figainin 1, a Novel Amphibian Skin Peptide with Antimicrobial and Antiproliferative Properties.
Doi : https://doi.org/10.3390/antibiotics9090625
Abstract : Amphibian skin secretions are abundant in bioactive compounds, especially antimicrobial peptides. These molecules are generally cationic and rich in hydrophobic amino acids, have an amphipathic structure and adopt an α-helical conformation when in contact with microorganisms membranes. In this work, we purified and characterized Figainin 1, a novel antimicrobial and antiproliferative peptide from the cutaneous secretion of the frog Boana raniceps. Figainin 1 is a cationic peptide with eighteen amino acid residues-rich in leucine and isoleucine, with an amidated C-terminus-and adopts an α-helical conformation in the presence of trifluoroethanol (TFE). It displayed activity against Gram-negative and especially Gram-positive bacteria, with MIC values ranging from 2 to 16 µM, and showed an IC<sub>50</sub> value of 15.9 µM against epimastigote forms of T. cruzi; however, Figanin 1 did not show activity against Candida species. This peptide also showed cytolytic effects against human erythrocytes with an HC<sub>50</sub> of 10 µM, in addition to antiproliferative activity against cancer cells and murine fibroblasts, with IC<sub>50</sub> values ranging from 10.5 to 13.7 µM. Despite its adverse effects on noncancerous cells, Figainin 1 exhibits interesting properties for the development of new anticancer agents and anti-infective drugs against pathogenic microorganisms.