dbacp03282
General Description
Peptide name : hBD-1
Source/Organism : Airway, hemofiltrates, urine, kidney; keratinocytes; skin; platelets; oral saliva; milk, mammary gland epithelium, colonic mucosa, Human
Linear/Cyclic : Not found
Chirality : L
Sequence Information
Sequence : DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
Peptide length: 36
C-terminal modification: Not found
N-terminal modification : Free
Non-natural peptide information: None
Activity Information
Assay type : Not specified
Assay time : Not found
Activity : Not found
Cell line : Not found
Cancer type : Fibrosarcoma
Other activity : Not found
Physicochemical Properties
Amino acid composition bar chart :
Molecular mass : 3934.5484 Dalton
Aliphatic index : 0.461
Instability index : 34.4917
Hydrophobicity (GRAVY) : -0.272
Isoelectric point : 8.8709
Charge (pH 7) : 3.782
Aromaticity : 0.111
Molar extinction coefficient (cysteine, cystine): (4470, 4845)
Hydrophobic/hydrophilic ratio : 1
hydrophobic moment : 0.0108
Missing amino acid : W,M,E
Most occurring amino acid : C
Most occurring amino acid frequency : 6
Least occurring amino acid : D
Least occurring amino acid frequency : 1
Structural Information
3D structure :
Secondary structure fraction (Helix, Turn, Sheet): (0.1, 0.2, 0.2)
SMILES Notation: CC[C@H](C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](CS)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CS)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H](N)CC(=O)O)C(C)C)[C@@H](C)CC)[C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCCN)C(=O)O)[C@@H](C)O
Secondary Structure :
| Method | Prediction |
|---|---|
| GOR | TCEEEEETTCCEEETTCCEEEEETTCCCTTTTTHHT |
| Chou-Fasman (CF) | CCEEEECCCEEEEECEEEEEEEEEEEECHHHHHCCC |
| Neural Network (NN) | CCCCCCCCCCCEECCCCCCCEECCCCCCCCCCCCCC |
| Joint/Consensus | CCEEEECCCCCEEECCCCEEEEECCCCCCCCCCCCC |
Molecular Descriptors and ADMET Properties
Molecular Descriptors: Click here to download
ADMET Properties: Click here to download
Cross Referencing databases
CancerPPD : Not available
ApIAPDB : Not available
CancerPPD2 ID : Not available
Reference
1 : Bensch KW, et al. hBD-1: a novel beta-defensin from human plasma. FEBS Lett. 1995; 368:331-5. doi: 10.1016/0014-5793(95)00687-5
Literature
Paper title : hBD-1: a novel beta-defensin from human plasma.
Doi : https://doi.org/10.1016/0014-5793(95)00687-5
Abstract : We report the isolation and characterization of a novel peptide with significant sequence homology to beta-defensins from human blood filtrate. The human beta-defensin-1 (hBD-1) is a short basic peptide of 36 amino acid residues. It contains six cysteines forming three intramolecular disulfide bonds. The molecular mass of hBD-1 is 3928.6 Da. Cloning of the specific cDNA confirmed the amino acid sequence of the native peptide. hBD-1 shares the nine conserved amino acids characteristic for beta-defensins from respiratory epithelial cells and neutrophils of cattle and chicken leukocytes. hBD-1 is present in nanomolar concentration in human plasma.