dbACP: A Comprehensive Database of Anti-Cancer Peptides

dbacp03282

General Description

Peptide name : hBD-1

Source/Organism : Airway, hemofiltrates, urine, kidney; keratinocytes; skin; platelets; oral saliva; milk, mammary gland epithelium, colonic mucosa, Human

Linear/Cyclic : Not found

Chirality : L

Sequence Information

Sequence : DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK

Peptide length: 36

C-terminal modification: Not found

N-terminal modification : Free

Non-natural peptide information: None

Activity Information

Assay type : Not specified

Assay time : Not found

Activity : Not found

Cell line : Not found

Cancer type : Fibrosarcoma

Other activity : Not found

Physicochemical Properties

Amino acid composition bar chart :

Molecular mass : 3934.5484 Dalton

Aliphatic index : 0.461

Instability index : 34.4917

Hydrophobicity (GRAVY) : -0.272

Isoelectric point : 8.8709

Charge (pH 7) : 3.782

Aromaticity : 0.111

Molar extinction coefficient (cysteine, cystine): (4470, 4845)

Hydrophobic/hydrophilic ratio : 1

hydrophobic moment : 0.0108

Missing amino acid : W,M,E

Most occurring amino acid : C

Most occurring amino acid frequency : 6

Least occurring amino acid : D

Least occurring amino acid frequency : 1

Structural Information

3D structure :

Secondary structure fraction (Helix, Turn, Sheet): (0.1, 0.2, 0.2)

SMILES Notation: CC[C@H](C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](CS)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CS)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H](N)CC(=O)O)C(C)C)[C@@H](C)CC)[C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCCN)C(=O)O)[C@@H](C)O

Secondary Structure :

Method Prediction
GOR TCEEEEETTCCEEETTCCEEEEETTCCCTTTTTHHT
Chou-Fasman (CF) CCEEEECCCEEEEECEEEEEEEEEEEECHHHHHCCC
Neural Network (NN) CCCCCCCCCCCEECCCCCCCEECCCCCCCCCCCCCC
Joint/Consensus CCEEEECCCCCEEECCCCEEEEECCCCCCCCCCCCC

Molecular Descriptors and ADMET Properties

Molecular Descriptors: Click here to download

ADMET Properties: Click here to download

Cross Referencing databases

Pubmed Id : 7628632

Uniprot : Not available

PDB : 1E4S

CancerPPD : Not available

ApIAPDB : Not available

CancerPPD2 ID : Not available

Reference

1 : Bensch KW, et al. hBD-1: a novel beta-defensin from human plasma. FEBS Lett. 1995; 368:331-5. doi: 10.1016/0014-5793(95)00687-5

Literature

Paper title : hBD-1: a novel beta-defensin from human plasma.

Doi : https://doi.org/10.1016/0014-5793(95)00687-5

Abstract : We report the isolation and characterization of a novel peptide with significant sequence homology to beta-defensins from human blood filtrate. The human beta-defensin-1 (hBD-1) is a short basic peptide of 36 amino acid residues. It contains six cysteines forming three intramolecular disulfide bonds. The molecular mass of hBD-1 is 3928.6 Da. Cloning of the specific cDNA confirmed the amino acid sequence of the native peptide. hBD-1 shares the nine conserved amino acids characteristic for beta-defensins from respiratory epithelial cells and neutrophils of cattle and chicken leukocytes. hBD-1 is present in nanomolar concentration in human plasma.