dbacp03330
General Description
Peptide name : Human A-defensin-1 (HNP1)
Source/Organism : Not found
Linear/Cyclic : Linear
Chirality : L
Sequence Information
Sequence : ACYCRIPACIAGERRYGTCIYQGRLWAFCC
Peptide length: 30
C-terminal modification: Linear
N-terminal modification : Not found
Non-natural peptide information: None
Activity Information
Assay type : MTT assay
Assay time : 48h
Activity : Not found
Cell line : COS-7
Cancer type : Lung cancer
Other activity : Not found
Physicochemical Properties
Amino acid composition bar chart :
Molecular mass : 3448.077 Dalton
Aliphatic index : 0.653
Instability index : 55.71
Hydrophobicity (GRAVY) : 0.3
Isoelectric point : 8.6783
Charge (pH 7) : 2.7362
Aromaticity : 0.166
Molar extinction coefficient (cysteine, cystine): (9970, 10345)
Hydrophobic/hydrophilic ratio : 2
hydrophobic moment : -0.040
Missing amino acid : H,M,K,S,D,N,V
Most occurring amino acid : C
Most occurring amino acid frequency : 6
Least occurring amino acid : P
Least occurring amino acid frequency : 1
Structural Information
3D structure :
Secondary structure fraction (Helix, Turn, Sheet): (0.2, 0.1, 0.3)
SMILES Notation: CC[C@H](C)[C@H](NC(=O)[C@H](CS)NC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CS)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CS)NC(=O)[C@H](C)N)[C@@H](C)CC)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)NCC(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)O)[C@@H](C)CC)[C@@H](C)O
Secondary Structure :
| Method | Prediction |
|---|---|
| GOR | TTETTCTTCHTTTTTTTEEEETCCEEHHHH |
| Chou-Fasman (CF) | EEEECEECCHHHHEEEEEEEECCHHHHCCC |
| Neural Network (NN) | CCCCCCCCCCCCCCCCCCEEECCCCEEEEC |
| Joint/Consensus | CCCCCCCCCCCCCCCCCEEEECCCCCCCCC |
Molecular Descriptors and ADMET Properties
Molecular Descriptors: Click here to download
ADMET Properties: Click here to download
Cross Referencing databases
CancerPPD : Not available
ApIAPDB : Not available
CancerPPD2 ID : Not available
Reference
1 : Xu N, et al. Human alpha-defensin-1 inhibits growth of human lung adenocarcinoma xenograft in nude mice. Mol Cancer Ther. 2008; 7:1588-97. doi: 10.1158/1535-7163.MCT-08-0010
Literature
Paper title : Human alpha-defensin-1 inhibits growth of human lung adenocarcinoma xenograft in nude mice.
Doi : https://doi.org/10.1158/1535-7163.MCT-08-0010
Abstract : Human alpha-defensin-1 (HNP1), a small antimicrobial peptide, shows cytotoxicity to tumor cells in vitro and inhibitory activity for pathologic neovascularization in vivo. Here, we did a gene therapy with a plasmid that expresses a secretable form of HNP1 for assaying its antitumor activity. The expression and secretion of HNP1 were determined by reverse transcription-PCR and ELISA in vitro. We found that expression of HNP1 in A549 tumor cells caused significant growth inhibition. This effect is most likely cell autonomous, as a significant amount of recombinant HNP1 protein was found to be accumulated in the cytoplasm by immunohistochemical staining using an anti-HNP1 antibody and the supernatant containing secreted HNP1 failed to produce any noticeable antitumor activity. Flow cytometry and Hoechst 33258 staining showed that the number of apoptotic cells among the A549 cells expressing recombinant HNP1 proteins was significantly greater than that of the nontransfected control cultures, suggesting that this growth-inhibitory activity was due to an apoptotic mechanism triggered by the intracellular HNP1. The antitumor activity of intracellularly expressed HNP1 was also shown in vivo. Decreased microvessel density and increased lymphocyte infiltration were observed in tumor tissue from HNP1-treated mice through histologic analysis. These results indicate that intracellularly expressed HNP1 induces tumor cell apoptosis, which inhibits tumor growth. The antiangiogenesis effect of HNP1 may contribute to its inhibitory activity in vivo, and HNP1 might involve the host immune response to tumor. These findings provide a rationale for developing HNP1-based gene therapy for cancer.