dbACP: A Comprehensive Database of Anti-Cancer Peptides

dbacp03536

General Description

Peptide name : L-amino oxidase (CP-LAAO) (LAO) (EC 1.4.3.2)

Source/Organism : Mangrove pit viper

Linear/Cyclic : Not found

Chirality : L

Sequence Information

Sequence : MNVFFMFSLLFLAALGSCADDRNPLEECFRETDYEEFLEIARXXXXTSNPKHVVRVGAGMSGLSAAYVLAGAGHQVTVLEASERPGGRXXXXXXXXEGWYANLGPMRXXXXXXXXXXXXXKFGLNLNEFSQENDNAWYFIKXXXXXXXXXXDPGLLKYPVKPSEAGKSAGQLYEESLGKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDEIVDGMDKLPTSMYQAIXXXXXXXXXXXXXXXXXXKVTVTYQTPAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIFLTCTKKFWEDDGIHGGKSTTDLPSRXXXXXXXXXXXXXXVIIAYGIGDDANFFQALDFKDCADIVFNDLSLIHQLPKEEIPSFCYPSMIQKXXXXXXXXXXITTFFTPYQFQHFSEAXXXXXXXIYFAGEYTAQAHGWIDSTIK

Peptide length: Not available

C-terminal modification: Not found

N-terminal modification : Free

Non-natural peptide information: None

Activity Information

Assay type : Not specified

Assay time : 72h

Activity : EC50 : 23.19 ± 1.57

Cell line : SW620

Cancer type : Colon cancer

Other activity : Not found

Physicochemical Properties

Amino Acid Composition Bar Chart : Not available

Molecular mass : Not available

Aliphatic index : Not available

Instability index : Not available

Hydrophobicity (GRAVY) : Not available

Isoelectric point : Not available

Charge (pH 7) : Not available

Aromaticity : Not available

Molar extinction coefficient (cysteine, cystine): Not available

Hydrophobic/hydrophilic ratio : Not available

hydrophobic moment : Not available

Missing amino acid : Not available

Most occurring amino acid : Not available

Most occurring amino acid frequency : Not available

Least occurring amino acid : Not available

Least occurring amino acid frequency : Not available

Structural Information

3D-structure: Not available

Secondary structure fraction (Helix, Turn, Sheet): Not available

SMILES Notation: Not available

Secondary Structure :

Method Prediction
GOR Not available
Chou-Fasman (CF) Not available
Neural Network (NN) Not available
Joint/Consensus Not available

Molecular Descriptors and ADMET Properties

Molecular descriptors: Not available

ADMET properties: Not available

Cross Referencing Databases databases

Pubmed Id : 29890640, .

Uniprot : Not available

CancerPPD : Not available

ApIAPDB : Not available

Reference

1 : Zainal Abidin SA, et al. Cytotoxic, Anti-Proliferative and Apoptosis Activity of l-Amino Acid Oxidase from Malaysian Cryptelytrops purpureomaculatus (CP-LAAO) Venom on Human Colon Cancer Cells. Molecules. 2018; 23:(unknown pages). doi: 10.3390/molecules23061388

Literature

Paper title : Cytotoxic, Anti-Proliferative and Apoptosis Activity of l-Amino Acid Oxidase from Malaysian Cryptelytrops purpureomaculatus (CP-LAAO) Venom on Human Colon Cancer Cells.

Doi : https://doi.org/10.3390/molecules23061388

Abstract : The aim of this study is to investigate the potential anti-cancer activity of l-amino acid oxidase (CP-LAAO) purified from the venom of Cryptelytrops purpureomaculatus on SW480 and SW620 human colon cancer cells. Mass spectrometry guided purification was able to identify and purify CP-LAAO. Amino acid variations identified from the partial protein sequence of CP-LAAO may suggest novel variants of these proteins. The activity of the purified CP-LAAO was confirmed with o-phenyldiamine (OPD)-based spectrophotometric assay. CP-LAAO demonstrated time- and dose-dependent cytotoxic activity and the EC<sub>50</sub> value was determined at 13 µg/mL for both SW480 and SW620 cells. Significant increase of caspase-3 activity, reduction of Bcl-2 levels, as well as morphological changes consistent with apoptosis were demonstrated by CP-LAAO. Overall, these data provide evidence on the potential anti-cancer activity of CP-LAAO from the venom of Malaysian C. purpureomaculatus for therapeutic intervention of human colon cancer.