dbacp03537
General Description
Peptide name : L-amino oxidase (CP-LAAO) (LAO) (EC 1.4.3.2)
Source/Organism : Mangrove pit viper
Linear/Cyclic : Not found
Chirality : L
Sequence Information
Sequence : MNVFFMFSLLFLAALGSCADDRNPLEECFRETDYEEFLEIARXXXXTSNPKHVVRVGAGMSGLSAAYVLAGAGHQVTVLEASERPGGRXXXXXXXXEGWYANLGPMRXXXXXXXXXXXXXKFGLNLNEFSQENDNAWYFIKXXXXXXXXXXDPGLLKYPVKPSEAGKSAGQLYEESLGKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDEIVDGMDKLPTSMYQAIXXXXXXXXXXXXXXXXXXKVTVTYQTPAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIFLTCTKKFWEDDGIHGGKSTTDLPSRXXXXXXXXXXXXXXVIIAYGIGDDANFFQALDFKDCADIVFNDLSLIHQLPKEEIPSFCYPSMIQKXXXXXXXXXXITTFFTPYQFQHFSEAXXXXXXXIYFAGEYTAQAHGWIDSTIK
Peptide length: Not available
C-terminal modification: Not found
N-terminal modification : Free
Non-natural peptide information: None
Activity Information
Assay type : Not specified
Assay time : 72h
Activity : EC50 : 15.99 ± 1.20
Cell line : CCD-18co
Cancer type : Colon cancer
Other activity : Not found
Physicochemical Properties
Amino Acid Composition Bar Chart : Not available
Molecular mass : Not available
Aliphatic index : Not available
Instability index : Not available
Hydrophobicity (GRAVY) : Not available
Isoelectric point : Not available
Charge (pH 7) : Not available
Aromaticity : Not available
Molar extinction coefficient (cysteine, cystine): Not available
Hydrophobic/hydrophilic ratio : Not available
hydrophobic moment : Not available
Missing amino acid : Not available
Most occurring amino acid : Not available
Most occurring amino acid frequency : Not available
Least occurring amino acid : Not available
Least occurring amino acid frequency : Not available
Structural Information
3D-structure: Not available
Secondary structure fraction (Helix, Turn, Sheet): Not available
SMILES Notation: Not available
Secondary Structure :
| Method | Prediction |
|---|---|
| GOR | Not available |
| Chou-Fasman (CF) | Not available |
| Neural Network (NN) | Not available |
| Joint/Consensus | Not available |
Molecular Descriptors and ADMET Properties
Molecular descriptors: Not available
ADMET properties: Not available
Cross Referencing Databases databases
Pubmed Id : 29890640, .
Uniprot : Not available
CancerPPD : Not available
ApIAPDB : Not available
Reference
1 : Zainal Abidin SA, et al. Cytotoxic, Anti-Proliferative and Apoptosis Activity of l-Amino Acid Oxidase from Malaysian Cryptelytrops purpureomaculatus (CP-LAAO) Venom on Human Colon Cancer Cells. Molecules. 2018; 23:(unknown pages). doi: 10.3390/molecules23061388
Literature
Paper title : Cytotoxic, Anti-Proliferative and Apoptosis Activity of l-Amino Acid Oxidase from Malaysian Cryptelytrops purpureomaculatus (CP-LAAO) Venom on Human Colon Cancer Cells.
Doi : https://doi.org/10.3390/molecules23061388
Abstract : The aim of this study is to investigate the potential anti-cancer activity of l-amino acid oxidase (CP-LAAO) purified from the venom of Cryptelytrops purpureomaculatus on SW480 and SW620 human colon cancer cells. Mass spectrometry guided purification was able to identify and purify CP-LAAO. Amino acid variations identified from the partial protein sequence of CP-LAAO may suggest novel variants of these proteins. The activity of the purified CP-LAAO was confirmed with o-phenyldiamine (OPD)-based spectrophotometric assay. CP-LAAO demonstrated time- and dose-dependent cytotoxic activity and the EC<sub>50</sub> value was determined at 13 µg/mL for both SW480 and SW620 cells. Significant increase of caspase-3 activity, reduction of Bcl-2 levels, as well as morphological changes consistent with apoptosis were demonstrated by CP-LAAO. Overall, these data provide evidence on the potential anti-cancer activity of CP-LAAO from the venom of Malaysian C. purpureomaculatus for therapeutic intervention of human colon cancer.