dbacp04310
General Description
Peptide name : Lunasin
Source/Organism : Plant sources
Linear/Cyclic : Linear
Chirality : L
Sequence Information
Sequence : SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRDDDDDDDDDD
Peptide length: 43
C-terminal modification: Linear
N-terminal modification : Not found
Non-natural peptide information: None
Activity Information
Assay type : MTT assay
Assay time : 1h
Activity : IC50 : 107.5 ± 1.9 μM
Cell line : HCT-116 parentl
Cancer type : Colorectal cancer
Other activity : Not found
Physicochemical Properties
Amino acid composition bar chart :
Molecular mass : 5086.3511 Dalton
Aliphatic index : 0.430
Instability index : 50.3558
Hydrophobicity (GRAVY) : -1.834
Isoelectric point : 4.3979
Charge (pH 7) : -7.3682
Aromaticity : 0.023
Molar extinction coefficient (cysteine, cystine): (5500, 5625)
Hydrophobic/hydrophilic ratio : 0.38709677
hydrophobic moment : 0.1056
Missing amino acid : A,F,Y
Most occurring amino acid : D
Most occurring amino acid frequency : 11
Least occurring amino acid : W
Least occurring amino acid frequency : 1
Structural Information
3D structure :
Secondary structure fraction (Helix, Turn, Sheet): (0.2, 0.4, 0.1)
SMILES Notation: CC[C@H](C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCSC)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CS)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CS)NC(=O)[C@H](CO)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CO)C(C)C)[C@@H](C)O)[C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)O
Secondary Structure :
| Method | Prediction |
|---|---|
| GOR | HHHHHTTHHHHHTETCCTCCHHHHHHHHHHHCCCCCCCCCCTT |
| Chou-Fasman (CF) | HHHHHHCCCHHHHEEEECCCHHHHHHHHEECCHHHHHHHHCCC |
| Neural Network (NN) | CCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCCCCCCC |
| Joint/Consensus | HHHHHCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCC |
Molecular Descriptors and ADMET Properties
Molecular Descriptors: Click here to download
ADMET Properties: Click here to download
Cross Referencing databases
CancerPPD : Not available
ApIAPDB : Not available
CancerPPD2 ID : Not available
Reference
1 : Fernández-Tomé S, et al. Inhibitory Effects of Peptide Lunasin in Colorectal Cancer HCT-116 Cells and Their Tumorsphere-Derived Subpopulation. Int J Mol Sci. 2020; 21:(unknown pages). doi: 10.3390/ijms21020537
Literature
Paper title : Inhibitory Effects of Peptide Lunasin in Colorectal Cancer HCT-116 Cells and Their Tumorsphere-Derived Subpopulation.
Doi : https://doi.org/10.3390/ijms21020537
Abstract : The involvement of cancer stem-like cells (CSC) in the tumor pathogenesis has profound implications for cancer therapy and chemoprevention. Lunasin is a bioactive peptide from soybean and other vegetal sources with proven protective activities against cancer and other chronic diseases. The present study focused on the cytotoxic effect of peptide lunasin in colorectal cancer HCT-116 cells, both the bulk tumor and the CSC subpopulations. Lunasin inhibited the proliferation and the tumorsphere-forming capacity of HCT-116 cells. Flow cytometry results demonstrated that the inhibitory effects were related to apoptosis induction and cell cycle-arrest at G1 phase. Moreover, lunasin caused an increase in the sub-GO/G1 phase of bulk tumor cells, linked to the apoptotic events found. Immunoblotting analysis further showed that lunasin induced apoptosis through activation of caspase-3 and cleavage of PARP, and could modulate cell cycle progress through the cyclin-dependent kinase inhibitor p21. Together, these results provide new evidence on the chemopreventive activity of peptide lunasin on colorectal cancer by modulating both the parental and the tumorsphere-derived subsets of HCT-116 cells.