dbACP: A Comprehensive Database of Anti-Cancer Peptides

dbacp04633

General Description

Peptide name : mCRAMP

Source/Organism : Bone marrow, saliva, Mice

Linear/Cyclic : Linear

Chirality : Not found

Sequence Information

Sequence : GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ

Peptide length: 34

C-terminal modification: Linear

N-terminal modification : Free

Non-natural peptide information: None

Activity Information

Assay type : Not specified

Assay time : Not found

Activity : Not found

Cell line : Not found

Cancer type : Not found

Other activity : Anti-microbial activity

Physicochemical Properties

Amino acid composition bar chart :

Molecular mass : 3878.6095 Dalton

Aliphatic index : 0.888

Instability index : 17.9382

Hydrophobicity (GRAVY) : -0.894

Isoelectric point : 10.218

Charge (pH 7) : 5.7605

Aromaticity : 0.058

Molar extinction coefficient (cysteine, cystine): (0, 0)

Hydrophobic/hydrophilic ratio : 1

hydrophobic moment : -1.660

Missing amino acid : C,W,H,T,M,S,D,Y,A

Most occurring amino acid : K

Most occurring amino acid frequency : 8

Least occurring amino acid : R

Least occurring amino acid frequency : 1

Structural Information

3D structure :

Secondary structure fraction (Helix, Turn, Sheet): (0.4, 0.2, 0.2)

SMILES Notation: CC[C@H](C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(=O)O)NC(=O)CNC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)CN)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCC(N)=O)C(=O)O)C(C)C)[C@@H](C)CC)[C@@H](C)CC

Secondary Structure :

Method Prediction
GOR HHHHTTTHHHHHHHHHHHHHHHHHHHECCCCCTT
Chou-Fasman (CF) CCCCCCHHHHHHHHHEEECCCHHHHHEECCCCCC
Neural Network (NN) CCCCCCCCCHHHHHHHCCCCCCCCCCCCCCCCCC
Joint/Consensus CCCCCCCHHHHHHHHHCCCCCHHHHHCCCCCCCC

Molecular Descriptors and ADMET Properties

Molecular Descriptors: Click here to download

ADMET Properties: Click here to download

Cross Referencing databases

Pubmed Id : 11587792

Uniprot : Not available

PDB : Not available

CancerPPD : Not available

ApIAPDB : Not available

CancerPPD2 ID : Not available

Reference

1 : Pestonjamasp VK, et al. Processing site and gene structure for the murine antimicrobial peptide CRAMP. Peptides. 2001; 22:1643-50. doi: 10.1016/s0196-9781(01)00499-5

Literature

Paper title : Processing site and gene structure for the murine antimicrobial peptide CRAMP.

Doi : https://doi.org/10.1016/s0196-9781(01)00499-5

Abstract : Cathelicidins are a mammalian gene family notable for the presence of an antibiotic peptide encoded at the carboxy-terminal domain of the nascent pre-pro-protein. Following proteolytic release, this peptide has direct antimicrobial activity. To understand the function and regulation of cathelicidin we investigated the peptide processing site and gene structure of the mouse cathelicidin CRAMP. Amino acid sequencing of the purified native 5 kDa peptide identified the functionally critical amino terminal sequence of mature CRAMP. Characterization of the CRAMP gene (Cnlp) showed homology in structure and sequence identity in several potential transcription factors binding sites found in the human cathelicidin LL-37. Overall, CRAMP shows striking similarities with LL-37, making it a useful model for study of human cathelicidin function and regulation.