dbacp04633
General Description
Peptide name : mCRAMP
Source/Organism : Bone marrow, saliva, Mice
Linear/Cyclic : Linear
Chirality : Not found
Sequence Information
Sequence : GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
Peptide length: 34
C-terminal modification: Linear
N-terminal modification : Free
Non-natural peptide information: None
Activity Information
Assay type : Not specified
Assay time : Not found
Activity : Not found
Cell line : Not found
Cancer type : Not found
Other activity : Anti-microbial activity
Physicochemical Properties
Amino acid composition bar chart :
Molecular mass : 3878.6095 Dalton
Aliphatic index : 0.888
Instability index : 17.9382
Hydrophobicity (GRAVY) : -0.894
Isoelectric point : 10.218
Charge (pH 7) : 5.7605
Aromaticity : 0.058
Molar extinction coefficient (cysteine, cystine): (0, 0)
Hydrophobic/hydrophilic ratio : 1
hydrophobic moment : -1.660
Missing amino acid : C,W,H,T,M,S,D,Y,A
Most occurring amino acid : K
Most occurring amino acid frequency : 8
Least occurring amino acid : R
Least occurring amino acid frequency : 1
Structural Information
3D structure :
Secondary structure fraction (Helix, Turn, Sheet): (0.4, 0.2, 0.2)
SMILES Notation: CC[C@H](C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(=O)O)NC(=O)CNC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)CN)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCC(N)=O)C(=O)O)C(C)C)[C@@H](C)CC)[C@@H](C)CC
Secondary Structure :
| Method | Prediction |
|---|---|
| GOR | HHHHTTTHHHHHHHHHHHHHHHHHHHECCCCCTT |
| Chou-Fasman (CF) | CCCCCCHHHHHHHHHEEECCCHHHHHEECCCCCC |
| Neural Network (NN) | CCCCCCCCCHHHHHHHCCCCCCCCCCCCCCCCCC |
| Joint/Consensus | CCCCCCCHHHHHHHHHCCCCCHHHHHCCCCCCCC |
Molecular Descriptors and ADMET Properties
Molecular Descriptors: Click here to download
ADMET Properties: Click here to download
Cross Referencing databases
CancerPPD : Not available
ApIAPDB : Not available
CancerPPD2 ID : Not available
Reference
1 : Pestonjamasp VK, et al. Processing site and gene structure for the murine antimicrobial peptide CRAMP. Peptides. 2001; 22:1643-50. doi: 10.1016/s0196-9781(01)00499-5
Literature
Paper title : Processing site and gene structure for the murine antimicrobial peptide CRAMP.
Doi : https://doi.org/10.1016/s0196-9781(01)00499-5
Abstract : Cathelicidins are a mammalian gene family notable for the presence of an antibiotic peptide encoded at the carboxy-terminal domain of the nascent pre-pro-protein. Following proteolytic release, this peptide has direct antimicrobial activity. To understand the function and regulation of cathelicidin we investigated the peptide processing site and gene structure of the mouse cathelicidin CRAMP. Amino acid sequencing of the purified native 5 kDa peptide identified the functionally critical amino terminal sequence of mature CRAMP. Characterization of the CRAMP gene (Cnlp) showed homology in structure and sequence identity in several potential transcription factors binding sites found in the human cathelicidin LL-37. Overall, CRAMP shows striking similarities with LL-37, making it a useful model for study of human cathelicidin function and regulation.