dbacp04830
General Description
Peptide name : Neurotoxin BmK AGAP-SYPU2
Source/Organism : Manchurian scorpion
Linear/Cyclic : Linear
Chirality : Not found
Sequence Information
Sequence : VKDGYIVDDKNCAYFCGRNAYCDDECEKNGAESGYCQWAGVYGNACWCYKLPDKVPIRVPGRCNG
Peptide length: 65
C-terminal modification: Linear
N-terminal modification : Free
Non-natural peptide information: None
Activity Information
Assay type : Antitumor activity assays
Assay time : 24h
Activity : ED50 : 1.42 mg/kg
Cell line : Ehrlich ascites cells
Cancer type : Glioma
Other activity : Not found
Physicochemical Properties
Amino acid composition bar chart :
Molecular mass : 7253.0691 Dalton
Aliphatic index : 0.48
Instability index : 17.0462
Hydrophobicity (GRAVY) : -0.589
Isoelectric point : 5.1294
Charge (pH 7) : -1.3411
Aromaticity : 0.138
Molar extinction coefficient (cysteine, cystine): (19940, 20440)
Hydrophobic/hydrophilic ratio : 1.16666666
hydrophobic moment : 0.3466
Missing amino acid : H,T,M
Most occurring amino acid : G
Most occurring amino acid frequency : 8
Least occurring amino acid : F
Least occurring amino acid frequency : 1
Structural Information
3D structure :
Secondary structure fraction (Helix, Turn, Sheet): (0.2, 0.3, 0.2)
SMILES Notation: CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)C(C)C)C(=O)N[C@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CS)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CS)C(=O)NCC(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@H](C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CS)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CS)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)O)C(C)C)[C@@H](C)CC)C(C)C)C(C)C)C(C)C
Secondary Structure :
| Method | Prediction |
|---|---|
| GOR | ECTCCEETTTTTTEETTTCTTTCTHHHTTTTTTTEEEEETETTCTHHTTTCTCCCCEEETTTTTT |
| Chou-Fasman (CF) | CCEEEEHHHHCEEEECCCCCCHHHHHHHHHHCEEECCEEEECCCCEEECCCCCEEEEEECCCCCC |
| Neural Network (NN) | CCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCC |
| Joint/Consensus | CCCCCEECCCCCCEECCCCCCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCCCCCEEECCCCCC |
Molecular Descriptors and ADMET Properties
Molecular Descriptors: Click here to download
ADMET Properties: Click here to download
Cross Referencing databases
CancerPPD : Not available
ApIAPDB : Not available
CancerPPD2 ID : Not available
Reference
1 : Shao JH, et al. Purification, characterization, and bioactivity of a new analgesic-antitumor peptide from Chinese scorpion Buthus martensii Karsch. Peptides. 2014; 53:89-96. doi: 10.1016/j.peptides.2013.10.023
Literature
Paper title : Purification, characterization, and bioactivity of a new analgesic-antitumor peptide from Chinese scorpion Buthus martensii Karsch.
Doi : https://doi.org/10.1016/j.peptides.2013.10.023
Abstract : Scorpion venoms are complex mixtures of dozens or even hundreds of distinct proteins, many of which have diverse bioactivities. In this study, after bioassay-driven chromatographic purification, a new dual-function peptide with analgesic and antitumor activities was isolated and designated BmK AGAP-SYPU2. The first 12 amino acid residues were sequenced with Edman degradation. The cDNA was cloned by using rapid amplification of cDNA ends from the cDNA pool from scorpion glands. The amino acid sequence of BmK AGAP-SYPU2 was then deduced, and is consistent with the molecular mass measured with MALDI-TOF-MS. A preliminary pharmacological analysis revealed the following: in the dose-effect curve plotted with the mouse-twisting test, BmK AGAP-SYPU2 showed analgesic activity with an ED50 value of 1.42 mg/kg; in the time-effect curves plotted with a hot-plate procedure, BmK AGAP-SYPU2 had similar effects to those of the painkiller morphine, except for its longer duration. BmK AGAP-SYPU2 also showed antitumor activity against Ehrlich ascites tumor and S-180 fibrosarcoma models in vivo. Sequence alignment and homology modeling showed that BmK AGAP-SYPU2 is highly conserved relative to other scorpion α-toxins. However, a few different amino acids endow it with unique molecular properties, which may be responsible for its specific bioactivities. BmK AGAP-SYPU2, a new scorpion neurotoxin with dual functions, is a potential candidate drug amenable to exploitation and modification.