dbacp05106
General Description
Peptide name : PA10
Source/Organism : Synthetic construct
Linear/Cyclic : Not found
Chirality : Not found
Sequence Information
Sequence : RQIKIWFQNRRMKWKKGGGGNNETTSIQIAGSLHHHHHH
Peptide length: 39
C-terminal modification: Not found
N-terminal modification : Not found
Non-natural peptide information: None
Activity Information
Assay type : Cell viability assay
Assay time : 24h
Activity : MIC : 10 μM
Cell line : MCF10A
Cancer type : Breast cancer
Other activity : Not found
Physicochemical Properties
Amino acid composition bar chart :
Molecular mass : 4627.1812 Dalton
Aliphatic index : 0.525
Instability index : 30.1538
Hydrophobicity (GRAVY) : -1.315
Isoelectric point : 11.744
Charge (pH 7) : 6.2819
Aromaticity : 0.076
Molar extinction coefficient (cysteine, cystine): (11000, 11000)
Hydrophobic/hydrophilic ratio : 0.625
hydrophobic moment : 0.0996
Missing amino acid : C,P,D,Y,V
Most occurring amino acid : H
Most occurring amino acid frequency : 6
Least occurring amino acid : F
Least occurring amino acid frequency : 1
Structural Information
3D structure :
Secondary structure fraction (Helix, Turn, Sheet): (0.2, 0.2, 0.2)
SMILES Notation: CC[C@H](C)[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)CNC(=O)CNC(=O)CNC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CCCNC(=N)N)[C@@H](C)CC)[C@@H](C)CC)[C@@H](C)O)[C@@H](C)O)[C@@H](C)CC)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)O
Secondary Structure :
| Method | Prediction |
|---|---|
| GOR | HHHHHHHHHHHHHHETTTTCCCCEEEEEHHHHHHHHTTT |
| Chou-Fasman (CF) | CEEEEECCHHHHHHCCCCCCCCEEEEEEECCHHHHHCCC |
| Neural Network (NN) | CCHHHHHHHHHHHCCCCCCCCCCCCEEEEEHHHHHHCCC |
| Joint/Consensus | CCHHHHHHHHHHHHCCCCCCCCCEEEEEECHHHHHHCCC |
Molecular Descriptors and ADMET Properties
Molecular Descriptors: Click here to download
ADMET Properties: Click here to download
Cross Referencing databases
CancerPPD : Not available
ApIAPDB : Not available
CancerPPD2 ID : Not available
Reference
1 : Puvvula PK and Moon AM. Discovery and characterization of anti-cancer peptides from a random peptide library. PLoS One. 2024; 19:e0293072. doi: 10.1371/journal.pone.0293072
Literature
Paper title : Discovery and characterization of anti-cancer peptides from a random peptide library.
Doi : https://doi.org/10.1371/journal.pone.0293072
Abstract : We performed a forward genetic screen to discover peptides that specifically target breast cancer cells using a Penetratin tagged, random 15mer peptide library. We identified a group of novel peptides that specifically inhibited the proliferation and survival of breast cancer cells without affecting normal primary mammary epithelial cells or fibroblasts. The intrinsic apoptotic pathway is activated by these peptides in the face of abnormal expression of numerous cell cycle regulatory genes. Associated alterations in histone marks, nuclear structure, and levels of critical RNA binding proteins vary in a peptide specific manner. This study demonstrates a novel method for the discovery of new potential therapeutic peptides.