dbACP: A Comprehensive Database of Anti-Cancer Peptides

dbacp05124

General Description

Peptide name : PA49

Source/Organism : Synthetic construct

Linear/Cyclic : Not found

Chirality : Not found

Sequence Information

Sequence : RQIKIWFQNRRMKWKKGGAGVYTFLVGADNRGWEHHHHHH

Peptide length: 40

C-terminal modification: Not found

N-terminal modification : Not found

Non-natural peptide information: None

Activity Information

Assay type : Cell viability assay

Assay time : 24h

Activity : MIC : 10 μM

Cell line : HCC1806

Cancer type : Breast cancer

Other activity : Not found

Physicochemical Properties

Amino acid composition bar chart :

Molecular mass : 4920.5456 Dalton

Aliphatic index : 0.487

Instability index : 15.2675

Hydrophobicity (GRAVY) : -1.205

Isoelectric point : 11.053

Charge (pH 7) : 6.282

Aromaticity : 0.15

Molar extinction coefficient (cysteine, cystine): (17990, 17990)

Hydrophobic/hydrophilic ratio : 0.81818181

hydrophobic moment : -0.356

Missing amino acid : C,S,P

Most occurring amino acid : H

Most occurring amino acid frequency : 6

Least occurring amino acid : M

Least occurring amino acid frequency : 1

Structural Information

3D structure :

Secondary structure fraction (Helix, Turn, Sheet): (0.2, 0.2, 0.3)

SMILES Notation: CC[C@H](C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CCCNC(=N)N)[C@@H](C)CC)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)NCC(=O)N[C@@H](C)C(=O)NCC(=O)N[C@H](C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@H](C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)O)C(C)C)[C@@H](C)O)C(C)C

Secondary Structure :

Method Prediction
GOR HHHHHHHHHHHHHHTTTTTCEEEEEEEHHHTHHHHHHHHH
Chou-Fasman (CF) CEEEEECCHHHHHHCCCEEEEEEEECCCCCHHHHHHHCCC
Neural Network (NN) CCHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHHCCC
Joint/Consensus CCHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHHCCC

Molecular Descriptors and ADMET Properties

Molecular Descriptors: Click here to download

ADMET Properties: Click here to download

Cross Referencing databases

Pubmed Id : 38349913

Uniprot : Not available

PDB : Not available

CancerPPD : Not available

ApIAPDB : Not available

CancerPPD2 ID : Not available

Reference

1 : Puvvula PK and Moon AM. Discovery and characterization of anti-cancer peptides from a random peptide library. PLoS One. 2024; 19:e0293072. doi: 10.1371/journal.pone.0293072

Literature

Paper title : Discovery and characterization of anti-cancer peptides from a random peptide library.

Doi : https://doi.org/10.1371/journal.pone.0293072

Abstract : We performed a forward genetic screen to discover peptides that specifically target breast cancer cells using a Penetratin tagged, random 15mer peptide library. We identified a group of novel peptides that specifically inhibited the proliferation and survival of breast cancer cells without affecting normal primary mammary epithelial cells or fibroblasts. The intrinsic apoptotic pathway is activated by these peptides in the face of abnormal expression of numerous cell cycle regulatory genes. Associated alterations in histone marks, nuclear structure, and levels of critical RNA binding proteins vary in a peptide specific manner. This study demonstrates a novel method for the discovery of new potential therapeutic peptides.