dbACP: A Comprehensive Database of Anti-Cancer Peptides

dbacp05137

General Description

Peptide name : Pardaxin

Source/Organism : Red sea moses sole

Linear/Cyclic : Linear

Chirality : L

Sequence Information

Sequence : GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE

Peptide length: 33

C-terminal modification: Linear

N-terminal modification : Free

Non-natural peptide information: None

Activity Information

Assay type : MTT/MTS assay

Assay time : 24h

Activity : IC50 : 14.52 µg/ml

Cell line : HT-1080

Cancer type : Fibrosarcoma

Other activity : Anti-microbial activity

Physicochemical Properties

Amino acid composition bar chart :

Molecular mass : 3323.8306 Dalton

Aliphatic index : 1.124

Instability index : 39.5242

Hydrophobicity (GRAVY) : 0.7455

Isoelectric point : 8.5915

Charge (pH 7) : 0.7662

Aromaticity : 0.090

Molar extinction coefficient (cysteine, cystine): (0, 0)

Hydrophobic/hydrophilic ratio : 1.75

hydrophobic moment : -0.147

Missing amino acid : C,R,W,H,M,D,Y,N

Most occurring amino acid : S

Most occurring amino acid frequency : 7

Least occurring amino acid : T

Least occurring amino acid frequency : 1

Structural Information

3D structure :

Secondary structure fraction (Helix, Turn, Sheet): (0.3, 0.3, 0.3)

SMILES Notation: CC[C@H](C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1ccccc1)NC(=O)CN)[C@@H](C)CC)C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(=O)O)C(=O)O)C(C)C)[C@@H](C)O)[C@@H](C)CC

Secondary Structure :

Method Prediction
GOR HHHHECCCCCCCCTHEEEEEEEEEEEEETTCCE
Chou-Fasman (CF) HHHHEEEEEECCCEECCCEEEECCCCCCCCCCC
Neural Network (NN) CCCCCCCCCCCCCCHHHHHHHHCCECCCCCCCC
Joint/Consensus HHHHCCCCCCCCCCCCCCEEEECCCCCCCCCCC

Molecular Descriptors and ADMET Properties

Molecular Descriptors: Click here to download

ADMET Properties: Click here to download

Cross Referencing databases

Pubmed Id : 22073006

Uniprot : Not available

PDB : 1XC0

CancerPPD : Click here

ApIAPDB : Not available

CancerPPD2 ID : Not available

Reference

1 : Huang TC, et al. Pardaxin, an antimicrobial peptide, triggers caspase-dependent and ROS-mediated apoptosis in HT-1080 cells. Mar Drugs. 2011; 9:1995-2009. doi: 10.3390/md9101995

Literature

Paper title : Pardaxin, an antimicrobial peptide, triggers caspase-dependent and ROS-mediated apoptosis in HT-1080 cells.

Doi : https://doi.org/10.3390/md9101995

Abstract : Pardaxin is an antimicrobial peptide (AMP) that was first isolated from secretions of the Red Sea Moses sole. The role of pardaxin in inducing apoptosis for preventing cancer has not yet been investigated. In the present study, we examined the antitumor activity of pardaxin against human fibrosarcoma HT-1080 cells; pardaxin inhibited cell proliferation by inducing apoptosis, as demonstrated by an increase in the externalization of plasma membrane phosphatidylserine and the presence of chromatin condensation. Additionally, pardaxin-treated cells showed elevation of caspase-3/7 activities, disruption of the mitochondrial membrane potential, and accumulation of reactive oxygen species (ROS) production. Inhibition of ROS production and caspase-3/7 activities reduced pardaxin-induced effects. Taken together, these findings suggest that pardaxin may be a potential anticancer agent for selectively inducing apoptosis in cancer cells.