dbACP: A Comprehensive Database of Anti-Cancer Peptides

dbacp05170

General Description

Peptide name : Pardaxin-1

Source/Organism : Brown-lined reefcod

Linear/Cyclic : Linear

Chirality : L

Sequence Information

Sequence : GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE

Peptide length: 33

C-terminal modification: Linear

N-terminal modification : Free

Non-natural peptide information: None

Activity Information

Assay type : MTT/MTS assay

Assay time : 24h

Activity : 90 % Cytotoxicity at 50 mg/L

Cell line : HT-1080

Cancer type : Fibrosarcoma

Other activity : Anti-microbial

Physicochemical Properties

Amino acid composition bar chart :

Molecular mass : 3323.8306 Dalton

Aliphatic index : 1.124

Instability index : 39.5242

Hydrophobicity (GRAVY) : 0.7455

Isoelectric point : 8.5915

Charge (pH 7) : 0.7662

Aromaticity : 0.090

Molar extinction coefficient (cysteine, cystine): (0, 0)

Hydrophobic/hydrophilic ratio : 1.75

hydrophobic moment : -0.147

Missing amino acid : C,R,W,H,M,D,Y,N

Most occurring amino acid : S

Most occurring amino acid frequency : 7

Least occurring amino acid : T

Least occurring amino acid frequency : 1

Structural Information

3D structure :

Secondary structure fraction (Helix, Turn, Sheet): (0.3, 0.3, 0.3)

SMILES Notation: CC[C@H](C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1ccccc1)NC(=O)CN)[C@@H](C)CC)C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(=O)O)C(=O)O)C(C)C)[C@@H](C)O)[C@@H](C)CC

Secondary Structure :

Method Prediction
GOR HHHHECCCCCCCCTHEEEEEEEEEEEEETTCCE
Chou-Fasman (CF) HHHHEEEEEECCCEECCCEEEECCCCCCCCCCC
Neural Network (NN) CCCCCCCCCCCCCCHHHHHHHHCCECCCCCCCC
Joint/Consensus HHHHCCCCCCCCCCCCCCEEEECCCCCCCCCCC

Molecular Descriptors and ADMET Properties

Molecular Descriptors: Click here to download

ADMET Properties: Click here to download

Cross Referencing databases

Pubmed Id : 23598079

Uniprot : Not available

PDB : 1XC0

CancerPPD : Click here

ApIAPDB : Not available

CancerPPD2 ID : Not available

Reference

1 : Lin MC, et al. Truncated antimicrobial peptides from marine organisms retain anticancer activity and antibacterial activity against multidrug-resistant Staphylococcus aureus. Peptides. 2013; 44:139-48. doi: 10.1016/j.peptides.2013.04.004

Literature

Paper title : Truncated antimicrobial peptides from marine organisms retain anticancer activity and antibacterial activity against multidrug-resistant Staphylococcus aureus.

Doi : https://doi.org/10.1016/j.peptides.2013.04.004

Abstract : Antimicrobial peptides (AMPs) were recently determined to be potential candidates for treating drug-resistant bacterial infections. The aim of this study was to develop shorter AMP fragments that combine maximal bactericidal effect with minimal synthesis cost. We first synthesized a series of truncated forms of AMPs (anti-lipopolysaccharide factor from shrimp, epinecidin from grouper, and pardaxin from Pardachirus marmoratus). The minimum inhibitory concentrations (MICs) of modified AMPs against ten bacterial species were determined. We also examined the synergy between peptide and non-peptide antibiotics. In addition, we measured the inhibitory rate of cancer cells treated with AMPs by MTS assay. We found that two modified antibacterial peptides (epinecidin-8 and pardaxin-6) had a broad range of action against both gram-positive and gram-negative bacteria. Furthermore, epinecidin and pardaxin were demonstrated to have high antibacterial and anticancer activities, and both AMPs resulted in a significant synergistic improvement in the potencies of streptomycin and kanamycin against methicillin-resistant Staphylococcus aureus. Neither AMP induced significant hemolysis at their MICs. In addition, both AMPs inhibited human epithelial carcinoma (HeLa) and fibrosarcoma (HT-1080) cell growth. The functions of these truncated AMPs were similar to those of their full-length equivalents. In conclusion, we have successfully identified shorter, inexpensive fragments with maximal bactericidal activity. This study also provides an excellent basis for the investigation of potential synergies between peptide and non-peptide antibiotics, for a broad range of antimicrobial and anticancer activities.