dbACP: A Comprehensive Database of Anti-Cancer Peptides

dbacp05225

General Description

Peptide name : Penaeidin-2a

Source/Organism : Penoeid shrimp

Linear/Cyclic : Linear

Chirality : Not found

Sequence Information

Sequence : YRGGYTGPIPRPPPIGRPPFRPVCNACYRLSVSDARNCCIKFGSCCHLVK

Peptide length: 50

C-terminal modification: Linear

N-terminal modification : Amidation

Non-natural peptide information: None

Activity Information

Assay type : Not specified

Assay time : 24h

Activity : MIC : 2.5–5 μM

Cell line : Not found

Cancer type : Not found

Other activity : Not found

Physicochemical Properties

Amino acid composition bar chart :

Molecular mass : 5524.4813 Dalton

Aliphatic index : 0.604

Instability index : 48.89

Hydrophobicity (GRAVY) : -0.248

Isoelectric point : 9.5495

Charge (pH 7) : 6.7839

Aromaticity : 0.1

Molar extinction coefficient (cysteine, cystine): (4470, 4845)

Hydrophobic/hydrophilic ratio : 1.63157894

hydrophobic moment : 0.0882

Missing amino acid : Q,W,M,E

Most occurring amino acid : P

Most occurring amino acid frequency : 8

Least occurring amino acid : T

Least occurring amino acid frequency : 1

Structural Information

3D structure :

Secondary structure fraction (Helix, Turn, Sheet): (0.1, 0.3, 0.2)

SMILES Notation: CC[C@H](C)[C@H](NC(=O)[C@H](CS)NC(=O)[C@H](CS)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CS)NC(=O)[C@H](C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)CNC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](N)Cc1ccc(O)cc1)[C@@H](C)O)[C@@H](C)CC)[C@@H](C)CC)C(C)C)C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1ccccc1)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)O)C(C)C

Secondary Structure :

Method Prediction
GOR ETTTCCCCCCCCCCCCCCCCCTTTTTTEEEECCTTTTTEETTTTTTHHTT
Chou-Fasman (CF) CCEEEECCCCCCCEECCCCEECCCCEEEEEEHHHHCEEEECCCCCCCCCC
Neural Network (NN) CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCHHHCC
Joint/Consensus CCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCEEECCCCCCCCCC

Molecular Descriptors and ADMET Properties

Molecular Descriptors: Click here to download

ADMET Properties: Click here to download

Cross Referencing databases

Pubmed Id : 11028917

Uniprot : Not available

PDB : Not available

CancerPPD : Not available

ApIAPDB : Not available

CancerPPD2 ID : Not available

Reference

1 : Destoumieux D, et al. Penaeidins, a family of antimicrobial peptides from penaeid shrimp (Crustacea, Decapoda). Cell Mol Life Sci. 2000; 57:1260-71. doi: 10.1007/pl00000764

Literature

Paper title : Penaeidins, a family of antimicrobial peptides from penaeid shrimp (Crustacea, Decapoda).

Doi : https://doi.org/10.1007/pl00000764

Abstract : The production of antimicrobial peptides represents a first-line host defense mechanism of innate immunity that is widespread in nature. Only recently such effectors were isolated in crustacean species, whereas numerous antimicrobial peptides have been characterized from other arthropods, both insects and chelicerates. This review presents findings on a family of antimicrobial peptides, named penaeidins, isolated from the shrimp Penaeus vannamei. Their structure and antimicrobial properties as well as their immune function will be discussed through analyses of penaeidin gene expression and peptide distribution upon microbial challenge.