dbacp05225
General Description
Peptide name : Penaeidin-2a
Source/Organism : Penoeid shrimp
Linear/Cyclic : Linear
Chirality : Not found
Sequence Information
Sequence : YRGGYTGPIPRPPPIGRPPFRPVCNACYRLSVSDARNCCIKFGSCCHLVK
Peptide length: 50
C-terminal modification: Linear
N-terminal modification : Amidation
Non-natural peptide information: None
Activity Information
Assay type : Not specified
Assay time : 24h
Activity : MIC : 2.5–5 μM
Cell line : Not found
Cancer type : Not found
Other activity : Not found
Physicochemical Properties
Amino acid composition bar chart :
Molecular mass : 5524.4813 Dalton
Aliphatic index : 0.604
Instability index : 48.89
Hydrophobicity (GRAVY) : -0.248
Isoelectric point : 9.5495
Charge (pH 7) : 6.7839
Aromaticity : 0.1
Molar extinction coefficient (cysteine, cystine): (4470, 4845)
Hydrophobic/hydrophilic ratio : 1.63157894
hydrophobic moment : 0.0882
Missing amino acid : Q,W,M,E
Most occurring amino acid : P
Most occurring amino acid frequency : 8
Least occurring amino acid : T
Least occurring amino acid frequency : 1
Structural Information
3D structure :
Secondary structure fraction (Helix, Turn, Sheet): (0.1, 0.3, 0.2)
SMILES Notation: CC[C@H](C)[C@H](NC(=O)[C@H](CS)NC(=O)[C@H](CS)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CS)NC(=O)[C@H](C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)CNC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](N)Cc1ccc(O)cc1)[C@@H](C)O)[C@@H](C)CC)[C@@H](C)CC)C(C)C)C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1ccccc1)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)O)C(C)C
Secondary Structure :
| Method | Prediction |
|---|---|
| GOR | ETTTCCCCCCCCCCCCCCCCCTTTTTTEEEECCTTTTTEETTTTTTHHTT |
| Chou-Fasman (CF) | CCEEEECCCCCCCEECCCCEECCCCEEEEEEHHHHCEEEECCCCCCCCCC |
| Neural Network (NN) | CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCHHHCC |
| Joint/Consensus | CCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCEEECCCCCCCCCC |
Molecular Descriptors and ADMET Properties
Molecular Descriptors: Click here to download
ADMET Properties: Click here to download
Cross Referencing databases
CancerPPD : Not available
ApIAPDB : Not available
CancerPPD2 ID : Not available
Reference
1 : Destoumieux D, et al. Penaeidins, a family of antimicrobial peptides from penaeid shrimp (Crustacea, Decapoda). Cell Mol Life Sci. 2000; 57:1260-71. doi: 10.1007/pl00000764
Literature
Paper title : Penaeidins, a family of antimicrobial peptides from penaeid shrimp (Crustacea, Decapoda).
Doi : https://doi.org/10.1007/pl00000764
Abstract : The production of antimicrobial peptides represents a first-line host defense mechanism of innate immunity that is widespread in nature. Only recently such effectors were isolated in crustacean species, whereas numerous antimicrobial peptides have been characterized from other arthropods, both insects and chelicerates. This review presents findings on a family of antimicrobial peptides, named penaeidins, isolated from the shrimp Penaeus vannamei. Their structure and antimicrobial properties as well as their immune function will be discussed through analyses of penaeidin gene expression and peptide distribution upon microbial challenge.