dbacp05704
General Description
Peptide name : Psyle E
Source/Organism : Eumachia leptothyrsa**, New Guinea, Philippines, Sulawesi
Linear/Cyclic : Not found
Chirality : L
Sequence Information
Sequence : GVIPCGESCVFIPCISSVLGCSCKNKVCYRD
Peptide length: 31
C-terminal modification: Not found
N-terminal modification : Free
Non-natural peptide information: None
Activity Information
Assay type : Not specified
Assay time : Not found
Activity : Not found
Cell line : Not found
Cancer type : Not found
Other activity : Not found
Physicochemical Properties
Amino acid composition bar chart :
Molecular mass : 3280.9019 Dalton
Aliphatic index : 0.877
Instability index : 30.9935
Hydrophobicity (GRAVY) : 0.6516
Isoelectric point : 7.7695
Charge (pH 7) : 0.7048
Aromaticity : 0.064
Molar extinction coefficient (cysteine, cystine): (1490, 1865)
Hydrophobic/hydrophilic ratio : 1.81818181
hydrophobic moment : -0.013
Missing amino acid : W,H,T,Q,M,A
Most occurring amino acid : C
Most occurring amino acid frequency : 6
Least occurring amino acid : E
Least occurring amino acid frequency : 1
Structural Information
3D structure :
Secondary structure fraction (Helix, Turn, Sheet): (0.1, 0.3, 0.3)
SMILES Notation: CC[C@H](C)[C@H](NC(=O)[C@H](CS)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)[C@H](CS)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(=O)O)NC(=O)CNC(=O)[C@H](CS)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@@H](NC(=O)CN)C(C)C)[C@@H](C)CC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CS)C(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(=O)O)C(=O)O)C(C)C)C(C)C
Secondary Structure :
| Method | Prediction |
|---|---|
| GOR | EECCTCCTEEEECCECTEEECTTTTTTEEET |
| Chou-Fasman (CF) | EEECCCEEEEEEEEEEEEECCCCCEEECCCC |
| Neural Network (NN) | CCCCCCCCCCEEEECEEECCCCCCCCCCCCC |
| Joint/Consensus | EECCCCCCEEEEEEEEEEECCCCCCCCCCCC |
Molecular Descriptors and ADMET Properties
Molecular Descriptors: Click here to download
ADMET Properties: Click here to download
Cross Referencing databases
CancerPPD : Not available
ApIAPDB : Not available
CancerPPD2 ID : Not available
Reference
1 : Gerlach SL, et al. Isolation, characterization, and bioactivity of cyclotides from the Micronesian plant Psychotria leptothyrsa. J Nat Prod. 2010; 73:1207-13. doi: 10.1021/np9007365
Literature
Paper title : Isolation, characterization, and bioactivity of cyclotides from the Micronesian plant Psychotria leptothyrsa.
Doi : https://doi.org/10.1021/np9007365
Abstract : Cyclotides, the largest known family of head-to-tail cyclic peptides, have approximately 30 amino acid residues with a complex structure containing a circular peptide backbone and a cystine knot. They are found in plants from the Violaceae and Rubiaceae families and are speculated to function in plant protection. In addition to their insecticidal properties, cyclotides display cytotoxic, anti-HIV, antimicrobial, and inhibition of neurotensin binding activities. Although cyclotides are present in all violaceous species hitherto screened, their distribution and expression in Rubiaceae are not fully understood. In this study, we show that Psychotria leptothyrsa var. longicarpa (Rubiaceae) contains a suite of different cyclotides. The cyclotide fractions were isolated by RP-HPLC, and sequences of six new peptides, named psyles A-F, were determined by MS/MS sequencing. One of these, psyle C, is the first rubiaceous linear variant known. Psyles A, C, and E were analyzed in a fluorometric microculture assay to determine cytotoxicity toward the human lymphoma cell line U937-GTB. The IC(50) values of psyles A, C, and E were 26, 3.50, and 0.76 muM, respectively. This study expands the number of known rubiaceous cyclotides and shows that the linear cyclotide maintains cytotoxicity.