dbACP: A Comprehensive Database of Anti-Cancer Peptides

dbacp05704

General Description

Peptide name : Psyle E

Source/Organism : Eumachia leptothyrsa**, New Guinea, Philippines, Sulawesi

Linear/Cyclic : Not found

Chirality : L

Sequence Information

Sequence : GVIPCGESCVFIPCISSVLGCSCKNKVCYRD

Peptide length: 31

C-terminal modification: Not found

N-terminal modification : Free

Non-natural peptide information: None

Activity Information

Assay type : Not specified

Assay time : Not found

Activity : Not found

Cell line : Not found

Cancer type : Not found

Other activity : Not found

Physicochemical Properties

Amino acid composition bar chart :

Molecular mass : 3280.9019 Dalton

Aliphatic index : 0.877

Instability index : 30.9935

Hydrophobicity (GRAVY) : 0.6516

Isoelectric point : 7.7695

Charge (pH 7) : 0.7048

Aromaticity : 0.064

Molar extinction coefficient (cysteine, cystine): (1490, 1865)

Hydrophobic/hydrophilic ratio : 1.81818181

hydrophobic moment : -0.013

Missing amino acid : W,H,T,Q,M,A

Most occurring amino acid : C

Most occurring amino acid frequency : 6

Least occurring amino acid : E

Least occurring amino acid frequency : 1

Structural Information

3D structure :

Secondary structure fraction (Helix, Turn, Sheet): (0.1, 0.3, 0.3)

SMILES Notation: CC[C@H](C)[C@H](NC(=O)[C@H](CS)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)[C@H](CS)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(=O)O)NC(=O)CNC(=O)[C@H](CS)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@@H](NC(=O)CN)C(C)C)[C@@H](C)CC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CS)C(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(=O)O)C(=O)O)C(C)C)C(C)C

Secondary Structure :

Method Prediction
GOR EECCTCCTEEEECCECTEEECTTTTTTEEET
Chou-Fasman (CF) EEECCCEEEEEEEEEEEEECCCCCEEECCCC
Neural Network (NN) CCCCCCCCCCEEEECEEECCCCCCCCCCCCC
Joint/Consensus EECCCCCCEEEEEEEEEEECCCCCCCCCCCC

Molecular Descriptors and ADMET Properties

Molecular Descriptors: Click here to download

ADMET Properties: Click here to download

Cross Referencing databases

Pubmed Id : 20575512

Uniprot : Not available

PDB : Not available

CancerPPD : Not available

ApIAPDB : Not available

CancerPPD2 ID : Not available

Reference

1 : Gerlach SL, et al. Isolation, characterization, and bioactivity of cyclotides from the Micronesian plant Psychotria leptothyrsa. J Nat Prod. 2010; 73:1207-13. doi: 10.1021/np9007365

Literature

Paper title : Isolation, characterization, and bioactivity of cyclotides from the Micronesian plant Psychotria leptothyrsa.

Doi : https://doi.org/10.1021/np9007365

Abstract : Cyclotides, the largest known family of head-to-tail cyclic peptides, have approximately 30 amino acid residues with a complex structure containing a circular peptide backbone and a cystine knot. They are found in plants from the Violaceae and Rubiaceae families and are speculated to function in plant protection. In addition to their insecticidal properties, cyclotides display cytotoxic, anti-HIV, antimicrobial, and inhibition of neurotensin binding activities. Although cyclotides are present in all violaceous species hitherto screened, their distribution and expression in Rubiaceae are not fully understood. In this study, we show that Psychotria leptothyrsa var. longicarpa (Rubiaceae) contains a suite of different cyclotides. The cyclotide fractions were isolated by RP-HPLC, and sequences of six new peptides, named psyles A-F, were determined by MS/MS sequencing. One of these, psyle C, is the first rubiaceous linear variant known. Psyles A, C, and E were analyzed in a fluorometric microculture assay to determine cytotoxicity toward the human lymphoma cell line U937-GTB. The IC(50) values of psyles A, C, and E were 26, 3.50, and 0.76 muM, respectively. This study expands the number of known rubiaceous cyclotides and shows that the linear cyclotide maintains cytotoxicity.