dbACP: A Comprehensive Database of Anti-Cancer Peptides

dbacp05784

General Description

Peptide name : Putative NRPS

Source/Organism : Uncultured bacterium

Linear/Cyclic : Cyclic

Chirality : Not found

Sequence Information

Sequence : GPTESTTFACCYAIKPEDAFATGSVPIGRPIANTQLYILDGQLQPVPVGVAGELHIGGDGLARGYLNRPELTAEKFIAHPFSDEPGARLYKTGDLRA

Peptide length: 97

C-terminal modification: Cyclic

N-terminal modification : Not found

Non-natural peptide information: None

Activity Information

Assay type : Not specified

Assay time : Not found

Activity : Not found

Cell line : Not found

Cancer type : Not specified

Other activity : Not found

Physicochemical Properties

Amino acid composition bar chart :

Molecular mass : 10271.4834 Dalton

Aliphatic index : 0.836

Instability index : 48.1784

Hydrophobicity (GRAVY) : -0.147

Isoelectric point : 5.1898

Charge (pH 7) : -3.0699

Aromaticity : 0.082

Molar extinction coefficient (cysteine, cystine): (5960, 6085)

Hydrophobic/hydrophilic ratio : 1.425

hydrophobic moment : -0.261

Missing amino acid : W,M

Most occurring amino acid : G

Most occurring amino acid frequency : 12

Least occurring amino acid : C

Least occurring amino acid frequency : 2

Structural Information

3D structure :

Secondary structure fraction (Helix, Turn, Sheet): (0.3, 0.3, 0.3)

SMILES Notation: CC[C@H](C)[C@H](NC(=O)[C@H](C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CS)NC(=O)[C@H](CS)NC(=O)[C@H](C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](NC(=O)[C@@H]1CCCN1C(=O)CN)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CCCNC(=N)N)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(=O)O)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)NCC(=O)N[C@H](C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@H](C(=O)NCC(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](C)C(=O)O)[C@@H](C)O)[C@@H](C)CC)[C@@H](C)O)[C@@H](C)CC)C(C)C)C(C)C)C(C)C)[C@@H](C)CC)[C@@H](C)O)[C@@H](C)CC)[C@@H](C)CC)C(C)C)[C@@H](C)O

Secondary Structure :

Method Prediction
GOR CCCCCEEEHHHHTTCCCHHHHTTCCCECCCCCCCEEEEEETCCCCCEEEEEEEEEETCCCCETTCTTCTTHHHHHHHHCCTCCCTTHHHETTCCHHH
Chou-Fasman (CF) CCEEEEECEEEEHHHHHHHCCEEEEEEECCCCEEEEEEHHHHCCEEEEEHHHHEECCCCCCCEEECCHHHHHHHHHHHCCCCCCCCCCEECCCCCCC
Neural Network (NN) CCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCECCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCCCH
Joint/Consensus CCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCEEECCCCEECCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCEECCCCCCC

Molecular Descriptors and ADMET Properties

Molecular Descriptors: Click here to download

ADMET Properties: Click here to download

Cross Referencing databases

Pubmed Id : 22629306

Uniprot : Not available

PDB : Not available

CancerPPD : Not available

ApIAPDB : Not available

CancerPPD2 ID : Not available

Reference

1 : Miller KI, et al. Investigation of the biosynthetic potential of endophytes in traditional Chinese anticancer herbs. PLoS One. 2012; 7:e35953. doi: 10.1371/journal.pone.0035953

Literature

Paper title : Investigation of the biosynthetic potential of endophytes in traditional Chinese anticancer herbs.

Doi : https://doi.org/10.1371/journal.pone.0035953

Abstract : Traditional Chinese medicine encompasses a rich empirical knowledge of the use of plants for the treatment of disease. In addition, the microorganisms associated with medicinal plants are also of interest as the producers of the compounds responsible for the observed plant bioactivity. The present study has pioneered the use of genetic screening to assess the potential of endophytes to synthesize bioactive compounds, as indicated by the presence of non-ribosomal peptide synthetase (NRPS) and polyketide synthase (PKS) genes. The total DNA extracts of 30 traditional Chinese herbs, were screened for functional genes involved in the biosynthesis of bioactive compounds. The four PCR screens were successful in targeting four bacterial PKS, six bacterial NRPS, ten fungal PKS and three fungal NRPS gene fragments. Analysis of the detected endophyte gene fragments afforded consideration of the possible bioactivity of the natural products produced by endophytes in medicinal herbs. This investigation describes a rapid method for the initial screening of medicinal herbs and has highlighted a subset of those plants that host endophytes with biosynthetic potential. These selected plants can be the focus of more comprehensive endophyte isolation and natural product studies.