dbacp06146
General Description
Peptide name : Ss-arasin
Source/Organism : The Indian mud crab
Linear/Cyclic : Linear
Chirality : Not found
Sequence Information
Sequence : SPRVRRRYGRPFGGRPFVGGQFGGRPGCVCIRSPCPCANYG
Peptide length: 41
C-terminal modification: Linear
N-terminal modification : Free
Non-natural peptide information: None
Activity Information
Assay type : MTT assay
Assay time : 24h
Activity : IC 50 : 2.90 μM
Cell line : HT-29
Cancer type : Human cervical carcinoma
Other activity : Anti-bacterial activity
Physicochemical Properties
Amino acid composition bar chart :
Molecular mass : 4442.1081 Dalton
Aliphatic index : 0.331
Instability index : 89.8171
Hydrophobicity (GRAVY) : -0.563
Isoelectric point : 11.219
Charge (pH 7) : 7.4185
Aromaticity : 0.122
Molar extinction coefficient (cysteine, cystine): (2980, 3230)
Hydrophobic/hydrophilic ratio : 1.92857142
hydrophobic moment : 0.3503
Missing amino acid : W,H,T,M,E,K,D,L
Most occurring amino acid : G
Most occurring amino acid frequency : 9
Least occurring amino acid : Q
Least occurring amino acid frequency : 1
Structural Information
3D structure :
Secondary structure fraction (Helix, Turn, Sheet): (0.0, 0.4, 0.2)
SMILES Notation: CC[C@H](C)[C@H](NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)[C@H](CS)NC(=O)CNC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)CNC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)CNC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)CNC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CO)C(C)C)C(C)C)C(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CS)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CS)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)NCC(=O)O
Secondary Structure :
| Method | Prediction |
|---|---|
| GOR | CCTEEETTTCCTTCCCEEECCCTCCTTEEEETCTCCTTTTT |
| Chou-Fasman (CF) | EEEEEEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCCC |
| Neural Network (NN) | CCCCEEECCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCC |
| Joint/Consensus | CCCEEEECCCCCCCCCEECCCCCCCCCEEEECCCCCCCCCC |
Molecular Descriptors and ADMET Properties
Molecular Descriptors: Click here to download
ADMET Properties: Click here to download
Cross Referencing databases
CancerPPD : Not available
ApIAPDB : Not available
CancerPPD2 ID : Not available
Reference
1 : Anju A, et al. Molecular characterization, recombinant expression and bioactivity profile of an antimicrobial peptide, Ss-arasin from the Indian mud crab, Scylla serrata. Fish Shellfish Immunol. 2019; 88:352-358. doi: 10.1016/j.fsi.2019.03.007
Literature
Paper title : Molecular characterization, recombinant expression and bioactivity profile of an antimicrobial peptide, Ss-arasin from the Indian mud crab, Scylla serrata.
Doi : https://doi.org/10.1016/j.fsi.2019.03.007
Abstract : Antimicrobial peptides (AMP) are potential alternatives to conventional antibiotics with the prospect to treat infections caused by multidrug resistant bacteria. This is the report of the first arasin sequence from the mud crab, Scylla serrata, designated as Ss-arasin. The complete cDNA sequences of the open reading frame (ORF) is comprised of 198 bp encoding 65 amino acid with a predicted molecular weight of 7 kDa and a predicted isoelectric point of 10.68. The sequence of the N-terminal 24 amino acid residues is indicative of a signal sequence directing the newly synthesize protein toward the secretory pathway. The 41-residue mature peptide is composed of two domains, an N-terminal Gly/Arg-rich domain and a C-terminal cysteine-rich domain. Challenging the mud crab with lipopolysaccharide (LPS) increased expression of Ss-arasin mRNA in haemocytes, reaching the highest level at 6 h, before dropping to basal levels at 24 h. Recombinant rSs-arasin showed antimicrobial activity against three bacterial species Staphylococcus aureus (40 mM), Pseudomonas aeruginosa (40 mM) and Escherichia coli (40 mM) implying significant anti-bacterial action. In addition, recombinant rSs-arasin inhibited human cervical carcinoma (HeLa) and colon carcinoma (HT-29) cell growth. These initial findings are encouraging to further study the structure-activity relationships to optimize these biological functions for future drug development.