dbacp06390
General Description
Peptide name : Turgencin A
Source/Organism : Tunicate
Linear/Cyclic : Cyclic
Chirality : L
Sequence Information
Sequence : GPKTKAACKMACKLATCGKKPGGWKCKLCELGCDAV-NH2
Peptide length: Not available
C-terminal modification: Cyclic
N-terminal modification : Amidation
Non-natural peptide information: None
Activity Information
Assay type : Human cell viability assay
Assay time : 72h
Activity : IC50 : 1.4 μM
Cell line : A2058
Cancer type : Melanoma cancer
Other activity : Anti-microbial activity
Physicochemical Properties
Amino Acid Composition Bar Chart : Not available
Molecular mass : Not available
Aliphatic index : Not available
Instability index : Not available
Hydrophobicity (GRAVY) : Not available
Isoelectric point : Not available
Charge (pH 7) : Not available
Aromaticity : Not available
Molar extinction coefficient (cysteine, cystine): Not available
Hydrophobic/hydrophilic ratio : Not available
hydrophobic moment : Not available
Missing amino acid : Not available
Most occurring amino acid : Not available
Most occurring amino acid frequency : Not available
Least occurring amino acid : Not available
Least occurring amino acid frequency : Not available
Structural Information
3D-structure: Not available
Secondary structure fraction (Helix, Turn, Sheet): Not available
SMILES Notation: Not available
Secondary Structure :
| Method | Prediction |
|---|---|
| GOR | Not available |
| Chou-Fasman (CF) | Not available |
| Neural Network (NN) | Not available |
| Joint/Consensus | Not available |
Molecular Descriptors and ADMET Properties
Molecular descriptors: Not available
ADMET properties: Not available
Cross Referencing Databases databases
Pubmed Id : 31940927, .
Uniprot : Click here
CancerPPD : Not available
ApIAPDB : Not available
Reference
1 : Hansen IKØ, et al. Isolation and Characterization of Antimicrobial Peptides with Unusual Disulfide Connectivity from the Colonial Ascidian Synoicum turgens. Mar Drugs. 2020; 18:(unknown pages). doi: 10.3390/md18010051
Literature
Paper title : Isolation and Characterization of Antimicrobial Peptides with Unusual Disulfide Connectivity from the Colonial Ascidian Synoicum turgens.
Doi : https://doi.org/10.3390/md18010051
Abstract : This study reports the isolation of two novel cysteine-rich antibacterial peptides, turgencin A and turgencin B, along with their oxidized derivatives, from the Arctic marine colonial ascidian Synoicum turgens. The peptides are post-translationally modified, containing six cysteines with an unusual disulfide connectivity of Cys1-Cys6, Cys2-Cys5, and Cys3-Cys4 and an amidated C-terminus. Furthermore, the peptides contain methionine residues resulting in the isolation of peptides with different degrees of oxidation. The most potent peptide, turgencin A<sub>Mox1</sub> with one oxidized methionine, displayed antimicrobial activity against both Gram-negative and Gram-positive bacteria with a minimum inhibitory concentration (MIC) as low as 0.4 µM against selected bacterial strains. In addition, the peptide inhibited the growth of the melanoma cancer cell line A2058 (IC<sub>50</sub> = 1.4 µM) and the human fibroblast cell line MRC-5 (IC<sub>50</sub> = 4.8 µM). The results from this study show that natural peptides isolated from marine tunicates have the potential to be promising drug leads.