dbacp06391
General Description
Peptide name : Turgencin A
Source/Organism : Tunicate
Linear/Cyclic : Cyclic
Chirality : L
Sequence Information
Sequence : GPKTKAACKMACKLATCGKKPGGWKCKLCELGCDAV
Peptide length: 36
C-terminal modification: Cyclic
N-terminal modification : Amidation
Non-natural peptide information: None
Activity Information
Assay type : Human cell viability assay
Assay time : 72h
Activity : IC50 : 1.4 μM
Cell line : A2058
Cancer type : Melanoma cancer
Other activity : Anti-microbial activity
Physicochemical Properties
Amino acid composition bar chart :
Molecular mass : 3699.5464 Dalton
Aliphatic index : 0.544
Instability index : 49.6528
Hydrophobicity (GRAVY) : -0.116
Isoelectric point : 9.2445
Charge (pH 7) : 5.6966
Aromaticity : 0.027
Molar extinction coefficient (cysteine, cystine): (5500, 5875)
Hydrophobic/hydrophilic ratio : 2
hydrophobic moment : -0.285
Missing amino acid : R,H,Q,I,F,S,Y,N
Most occurring amino acid : K
Most occurring amino acid frequency : 8
Least occurring amino acid : M
Least occurring amino acid frequency : 1
Structural Information
3D structure :
Secondary structure fraction (Helix, Turn, Sheet): (0.5, 0.2, 0.1)
SMILES Notation: CSCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CS)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CN)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)NCC(=O)NCC(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CS)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)O)C(C)C)[C@@H](C)O
Secondary Structure :
| Method | Prediction |
|---|---|
| GOR | CCCCHHHHHHHHHHHHTTCCCTCCTTTTTHTTCHHH |
| Chou-Fasman (CF) | CCHHHHHHHHHHHHEECCCCCCCHHHHHHHCCCCCC |
| Neural Network (NN) | CCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCC |
| Joint/Consensus | CCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCC |
Molecular Descriptors and ADMET Properties
Molecular Descriptors: Click here to download
ADMET Properties: Click here to download
Cross Referencing databases
CancerPPD : Not available
ApIAPDB : Not available
CancerPPD2 ID : Not available
Reference
1 : Hansen IKØ, et al. Isolation and Characterization of Antimicrobial Peptides with Unusual Disulfide Connectivity from the Colonial Ascidian Synoicum turgens. Mar Drugs. 2020; 18:(unknown pages). doi: 10.3390/md18010051
Literature
Paper title : Isolation and Characterization of Antimicrobial Peptides with Unusual Disulfide Connectivity from the Colonial Ascidian Synoicum turgens.
Doi : https://doi.org/10.3390/md18010051
Abstract : This study reports the isolation of two novel cysteine-rich antibacterial peptides, turgencin A and turgencin B, along with their oxidized derivatives, from the Arctic marine colonial ascidian Synoicum turgens. The peptides are post-translationally modified, containing six cysteines with an unusual disulfide connectivity of Cys1-Cys6, Cys2-Cys5, and Cys3-Cys4 and an amidated C-terminus. Furthermore, the peptides contain methionine residues resulting in the isolation of peptides with different degrees of oxidation. The most potent peptide, turgencin A<sub>Mox1</sub> with one oxidized methionine, displayed antimicrobial activity against both Gram-negative and Gram-positive bacteria with a minimum inhibitory concentration (MIC) as low as 0.4 µM against selected bacterial strains. In addition, the peptide inhibited the growth of the melanoma cancer cell line A2058 (IC<sub>50</sub> = 1.4 µM) and the human fibroblast cell line MRC-5 (IC<sub>50</sub> = 4.8 µM). The results from this study show that natural peptides isolated from marine tunicates have the potential to be promising drug leads.