dbACP: A Comprehensive Database of Anti-Cancer Peptides

dbacp06464

General Description

Peptide name : Varv peptide B (Varv B; Plant defensin)

Source/Organism : Field pansy

Linear/Cyclic : Cyclic

Chirality : L

Sequence Information

Sequence : GLPVCGETCFGGTCNTPGCSCDPWPMCSRN

Peptide length: 30

C-terminal modification: Cyclic

N-terminal modification : Not found

Non-natural peptide information: None

Activity Information

Assay type : Nonclonogenic fluorometric microculture cytotoxicity assay

Assay time : Not found

Activity : Not found

Cell line : Not found

Cancer type : Leukemia

Other activity : Not found

Physicochemical Properties

Amino acid composition bar chart :

Molecular mass : 3093.5169 Dalton

Aliphatic index : 0.226

Instability index : 42.7933

Hydrophobicity (GRAVY) : -0.126

Isoelectric point : 4.3701

Charge (pH 7) : -1.2954

Aromaticity : 0.066

Molar extinction coefficient (cysteine, cystine): (5500, 5875)

Hydrophobic/hydrophilic ratio : 2

hydrophobic moment : -0.074

Missing amino acid : H,Q,I,K,Y,A

Most occurring amino acid : C

Most occurring amino acid frequency : 6

Least occurring amino acid : L

Least occurring amino acid frequency : 1

Structural Information

3D structure :

Secondary structure fraction (Helix, Turn, Sheet): (0.1, 0.4, 0.2)

SMILES Notation: CSCC[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(=O)O)NC(=O)[C@H](CS)NC(=O)[C@H](CO)NC(=O)[C@H](CS)NC(=O)CNC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)CNC(=O)CNC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)[C@H](CCC(=O)O)NC(=O)CNC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(C)C)NC(=O)CN)C(C)C)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](CS)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(N)=O)C(=O)O

Secondary Structure :

Method Prediction
GOR CCCTTCCEEETCCCCCTTCCCCTCCTTTTT
Chou-Fasman (CF) EEEECCCEEEECCCCCCCCCCCCCCCCCCC
Neural Network (NN) CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Joint/Consensus CCCCCCCEEECCCCCCCCCCCCCCCCCCCC

Molecular Descriptors and ADMET Properties

Molecular Descriptors: Click here to download

ADMET Properties: Click here to download

Cross Referencing databases

Pubmed Id : 10075760

Uniprot : Not available

PDB : Not available

CancerPPD : Not available

ApIAPDB : Not available

CancerPPD2 ID : Not available

Reference

1 : Göransson U, et al. Seven novel macrocyclic polypeptides from Viola arvensis. J Nat Prod. 1999; 62:283-6. doi: 10.1021/np9803878

Literature

Paper title : Seven novel macrocyclic polypeptides from Viola arvensis.

Doi : https://doi.org/10.1021/np9803878

Abstract : Seven novel macrocyclic polypeptides, designated as varv peptides B-H, have been isolated from the aerial parts of Viola arvensis. Their primary structures have been elucidated by automated Edman degradation and mass spectrometry. They all consist of 29 or 30 amino acid residues, covalently cyclized via the amide backbone and by three internal disulfide bridges. Their amino acid sequences are as follows: varv peptide B, cyclo-(TCFGGTCNTPGCSCDPWPMCSRNGLPVCGE); varv peptide C, cyclo-(TCVGGTCNTPGCSCSWPVCTRNGVPICGE); varv peptide D, cyclo-(TCVGGSCNTPGCSCSWPVCTRNGLPICGE); varv peptide E, cyclo-(TCVGGTCNTPGCSCSWPVCTRNGLPICGE); varv peptide F, cyclo-(TCTLGTCYTAGCSCSWPVCTRNGVPICGE); varv peptide G, cyclo-(TCFGGTCNTPGCSCDPWPVCSRNGVPVCGE); and varv peptide H, cyclo-(TCFGGTCNTPGCSCETWPVCSRNGLPVCGE). The varv peptides B-H exhibited high degrees of homology with the hitherto known macrocyclic peptides varv peptide A, kalata B1, violapeptide I, circulins A and B, and cyclopsychotride A.