dbACP: A Comprehensive Database of Anti-Cancer Peptides

dbacp06505

General Description

Peptide name : Viphi D

Source/Organism : Chinese Violet herb

Linear/Cyclic : Not found

Chirality : L

Sequence Information

Sequence : GIPCGESCVFIPCISSVIGCSCSSKVCYRN

Peptide length: 30

C-terminal modification: Not found

N-terminal modification : Free

Non-natural peptide information: None

Activity Information

Assay type : Not specified

Assay time : Not found

Activity : Not found

Cell line : Not found

Cancer type : Not found

Other activity : Not found

Physicochemical Properties

Amino acid composition bar chart :

Molecular mass : 3112.6658 Dalton

Aliphatic index : 0.81

Instability index : 31.5033

Hydrophobicity (GRAVY) : 0.75

Isoelectric point : 7.7736

Charge (pH 7) : 0.7015

Aromaticity : 0.066

Molar extinction coefficient (cysteine, cystine): (1490, 1865)

Hydrophobic/hydrophilic ratio : 1.72727272

hydrophobic moment : -0.060

Missing amino acid : W,H,Q,T,M,D,L,A

Most occurring amino acid : C

Most occurring amino acid frequency : 6

Least occurring amino acid : E

Least occurring amino acid frequency : 1

Structural Information

3D structure :

Secondary structure fraction (Helix, Turn, Sheet): (0.0, 0.4, 0.3)

SMILES Notation: CC[C@H](C)[C@H](NC(=O)[C@H](CS)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)[C@H](CS)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(=O)O)NC(=O)CNC(=O)[C@H](CS)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)CN)[C@@H](C)CC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CS)C(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(N)=O)C(=O)O)C(C)C)[C@@H](C)CC)C(C)C

Secondary Structure :

Method Prediction
GOR CCCTCCTEEEECEEEEEEEEETTTTEEETT
Chou-Fasman (CF) EECCCEEEEEEEEEEEEECCCCEEEECCCC
Neural Network (NN) CCCCCCCCCEEECCCEEEEECCCCCEEECC
Joint/Consensus CCCCCCCEEEEEEEEEEEEECCCCCEEECC

Molecular Descriptors and ADMET Properties

Molecular Descriptors: Click here to download

ADMET Properties: Click here to download

Cross Referencing databases

Pubmed Id : 21723349

Uniprot : Not available

PDB : Not available

CancerPPD : Not available

ApIAPDB : Not available

CancerPPD2 ID : Not available

Reference

1 : He W, et al. Isolation and characterization of cytotoxic cyclotides from Viola philippica. Peptides. 2011; 32:1719-23. doi: 10.1016/j.peptides.2011.06.016

Literature

Paper title : Isolation and characterization of cytotoxic cyclotides from Viola philippica.

Doi : https://doi.org/10.1016/j.peptides.2011.06.016

Abstract : Cyclotides are a large family of plant peptides characterized by a macrocyclic backbone and knotted arrangement of three disulfide bonds. This unique structure renders cyclotides exceptionally stable to thermal, chemical and enzymatic treatments. They exhibit a variety of bioactivities, including uterotonic, anti-HIV, cytotoxic and hemolytic activity and it is these properties that make cyclotides an interesting peptide scaffold for drug design. In this study, eight new cyclotides (Viphi A-H), along with eight known cyclotides, were isolated from Viola philippica, a plant from the Violaceae family. In addition, Viba 17 and Mram 8 were isolated for the first time as peptides. The sequences of these cyclotides were elucidated primarily by using a strategy involving reduction, enzymatic digestion and tandem mass spectroscopy sequencing. Several of the cyclotides showed cytotoxic activities against the cancer cell lines MM96L, HeLa and BGC-823. The novel cyclotides reported here: (1) enhance the known sequence variation observed for cyclotides; (2) extend the number of species known to contain cyclotides; (3) provide interesting structure-activity relationships that delineate residues important for cytotoxic activity. In addition, this study provides insights into the potential active ingredients of traditional Chinese medicines.