dbACP: A Comprehensive Database of Anti-Cancer Peptides

dbacp06928

General Description

Peptide name : #6(M108-L127)

Source/Organism : STAP-2 PH domain–derived peptide

Linear/Cyclic : Linear

Chirality : L

Sequence Information

Sequence : RRRRRRRRGGMWKGFILTVVELRVPTDLTL

Peptide length: 30

C-terminal modification: Linear

N-terminal modification : Free

Non-natural peptide information:

Activity Information

Assay type : CellTiter-Glo assay

Assay time : 48-h

Activity : Graph figure 1-B

Cell line : MCF-7

Cancer type : Breast Cancer

Other activity : Anticancer

Physicochemical Properties

Amino acid composition bar chart :

Molecular mass : 3695.4018 Dalton

Aliphatic index : 0.94

Instability index : 161.033

Hydrophobicity (GRAVY) : -0.673

Isoelectric point : 12

Charge (pH 7) : 7.7629

Aromaticity : 6.666

Molar extinction coefficient (cysteine, cystine): (0, 0)

Hydrophobic/hydrophilic ratio : 1

hydrophobic moment : 0.0159

Missing amino acid : A,C,H,N,Q,S,Y

Most occurring amino acid : R

Most occurring amino acid frequency : 9

Least occurring amino acid : M

Least occurring amino acid frequency : 1

Structural Information

3D structure :

Secondary structure fraction (Helix, Turn, Sheet): (23., 16., 43.)

SMILES Notation: CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCSC)NC(=O)CNC(=O)CNC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](N)CCCNC(=N)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)O)[C@@H](C)O)[C@@H](C)O)C(C)C)C(C)C)C(C)C)[C@@H](C)O

Secondary Structure :

Method Prediction
GOR HHHHHHTTTTCEETEEEEEEEEECCCCCEE
Chou-Fasman (CF) HHHHHCCCCCCEEEEEEEECCEEECCCCCC
Neural Network (NN) CCCCHCCCCCCCCCEEEEEEECCCCCCCCE
Joint/Consensus HHHHHCCCCCCEEEEEEEEEEEECCCCCCC

Molecular Descriptors and ADMET Properties

Molecular Descriptors: Click here to download

ADMET Properties: Click here to download

Cross Referencing databases

Pubmed Id : 36410436.0

Uniprot : Not available

PDB : Not available

CancerPPD : Not available

ApIAPDB : Not available

CancerPPD2 ID: 7410

Reference

1 : Maemoto T, et al. A peptide derived from adaptor protein STAP-2 inhibits tumor progression by downregulating epidermal growth factor receptor signaling. J Biol Chem. 2023; 299:102724. doi: 10.1016/j.jbc.2022.102724

Literature

Paper title : A peptide derived from adaptor protein STAP-2 inhibits tumor progression by downregulating epidermal growth factor receptor signaling.

Doi : https://doi.org/10.1016/j.jbc.2022.102724

Abstract : Signal-transducing adaptor family member-2 (STAP-2) is an adaptor protein that regulates various intracellular signals. We previously demonstrated that STAP-2 binds to epidermal growth factor receptor (EGFR) and facilitates its stability and activation of EGFR signaling in prostate cancer cells. Inhibition of this interaction may be a promising direction for cancer treatment. Here, we found that 2D5 peptide, a STAP-2-derived peptide, blocked STAP-2-EGFR interactions and suppressed EGFR-mediated proliferation in several cancer cell lines. 2D5 peptide inhibited tumor growth of human prostate cancer cell line DU145 and human lung cancer cell line A549 in murine xenograft models. Additionally, we determined that EGFR signaling and its stability were decreased by 2D5 peptide treatment during EGF stimulation. In conclusion, our study shows that 2D5 peptide is a novel anticancer peptide that inhibits STAP-2-mediated activation of EGFR signaling and suppresses prostate and lung cancer progression.