dbacp06928
General Description
Peptide name : #6(M108-L127)
Source/Organism : STAP-2 PH domain–derived peptide
Linear/Cyclic : Linear
Chirality : L
Sequence Information
Sequence : RRRRRRRRGGMWKGFILTVVELRVPTDLTL
Peptide length: 30
C-terminal modification: Linear
N-terminal modification : Free
Non-natural peptide information:
Activity Information
Assay type : CellTiter-Glo assay
Assay time : 48-h
Activity : Graph figure 1-B
Cell line : MCF-7
Cancer type : Breast Cancer
Other activity : Anticancer
Physicochemical Properties
Amino acid composition bar chart :
Molecular mass : 3695.4018 Dalton
Aliphatic index : 0.94
Instability index : 161.033
Hydrophobicity (GRAVY) : -0.673
Isoelectric point : 12
Charge (pH 7) : 7.7629
Aromaticity : 6.666
Molar extinction coefficient (cysteine, cystine): (0, 0)
Hydrophobic/hydrophilic ratio : 1
hydrophobic moment : 0.0159
Missing amino acid : A,C,H,N,Q,S,Y
Most occurring amino acid : R
Most occurring amino acid frequency : 9
Least occurring amino acid : M
Least occurring amino acid frequency : 1
Structural Information
3D structure :
Secondary structure fraction (Helix, Turn, Sheet): (23., 16., 43.)
SMILES Notation: CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCSC)NC(=O)CNC(=O)CNC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](N)CCCNC(=N)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)O)[C@@H](C)O)[C@@H](C)O)C(C)C)C(C)C)C(C)C)[C@@H](C)O
Secondary Structure :
| Method | Prediction |
|---|---|
| GOR | HHHHHHTTTTCEETEEEEEEEEECCCCCEE |
| Chou-Fasman (CF) | HHHHHCCCCCCEEEEEEEECCEEECCCCCC |
| Neural Network (NN) | CCCCHCCCCCCCCCEEEEEEECCCCCCCCE |
| Joint/Consensus | HHHHHCCCCCCEEEEEEEEEEEECCCCCCC |
Molecular Descriptors and ADMET Properties
Molecular Descriptors: Click here to download
ADMET Properties: Click here to download
Cross Referencing databases
CancerPPD : Not available
ApIAPDB : Not available
CancerPPD2 ID: 7410
Reference
1 : Maemoto T, et al. A peptide derived from adaptor protein STAP-2 inhibits tumor progression by downregulating epidermal growth factor receptor signaling. J Biol Chem. 2023; 299:102724. doi: 10.1016/j.jbc.2022.102724
Literature
Paper title : A peptide derived from adaptor protein STAP-2 inhibits tumor progression by downregulating epidermal growth factor receptor signaling.
Doi : https://doi.org/10.1016/j.jbc.2022.102724
Abstract : Signal-transducing adaptor family member-2 (STAP-2) is an adaptor protein that regulates various intracellular signals. We previously demonstrated that STAP-2 binds to epidermal growth factor receptor (EGFR) and facilitates its stability and activation of EGFR signaling in prostate cancer cells. Inhibition of this interaction may be a promising direction for cancer treatment. Here, we found that 2D5 peptide, a STAP-2-derived peptide, blocked STAP-2-EGFR interactions and suppressed EGFR-mediated proliferation in several cancer cell lines. 2D5 peptide inhibited tumor growth of human prostate cancer cell line DU145 and human lung cancer cell line A549 in murine xenograft models. Additionally, we determined that EGFR signaling and its stability were decreased by 2D5 peptide treatment during EGF stimulation. In conclusion, our study shows that 2D5 peptide is a novel anticancer peptide that inhibits STAP-2-mediated activation of EGFR signaling and suppresses prostate and lung cancer progression.