dbACP: A Comprehensive Database of Anti-Cancer Peptides

dbacp07933

General Description

Peptide name : myristoyl-CM4

Source/Organism : Bombyx mori

Linear/Cyclic : Linear

Chirality : L

Sequence Information

Sequence : GRWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI

Peptide length: 36

C-terminal modification: Linear

N-terminal modification : Amidation

Non-natural peptide information:

Activity Information

Assay type : MTT assay

Assay time : 24-h

Activity : IC50 = 3 μM

Cell line : MX-1

Cancer type : Breast cancer

Other activity : Antimicrobial

Physicochemical Properties

Amino acid composition bar chart :

Molecular mass : 3819.5024 Dalton

Aliphatic index : 1.083

Instability index : 33.9111

Hydrophobicity (GRAVY) : 0.1139

Isoelectric point : 10.565

Charge (pH 7) : 4.759

Aromaticity : 5.555

Molar extinction coefficient (cysteine, cystine): (0, 0)

Hydrophobic/hydrophilic ratio : 1.7692

hydrophobic moment : 0.5401

Missing amino acid : C,H,L,M,S,Y

Most occurring amino acid : G

Most occurring amino acid frequency : 5

Least occurring amino acid : W

Least occurring amino acid frequency : 1

Structural Information

3D structure :

Secondary structure fraction (Helix, Turn, Sheet): (30., 22., 36.)

SMILES Notation: CC[C@H](C)[C@H](NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCCNC(=N)N)NC(=O)CN)[C@@H](C)CC)[C@@H](C)CC)C(C)C)[C@@H](C)CC)[C@@H](C)CC)C(C)C)C(C)C)C(C)C)C(C)C)[C@@H](C)O)C(=O)O

Secondary Structure :

Method Prediction
GOR HHHHHHHHHHHHTCCHEEEEEECCCHEEEEEHHHEE
Chou-Fasman (CF) CEEHHHHHHHEEEECEEEEECCCCCEEEEECCCCCC
Neural Network (NN) CCCHHHCCCCCCCCCCCCCCECCCCCEEHHHCCCCH
Joint/Consensus CCCHHHHHHHCCCCCCEEEEECCCCCEEEECCCCCC

Molecular Descriptors and ADMET Properties

Molecular Descriptors: Click here to download

ADMET Properties: Click here to download

Cross Referencing databases

Pubmed Id : 30483133.0

Uniprot : Not available

PDB : Not available

CancerPPD : Not available

ApIAPDB : Not available

CancerPPD2 ID: 5977

Reference

1 : Li C, et al. N-myristoylation of Antimicrobial Peptide CM4 Enhances Its Anticancer Activity by Interacting With Cell Membrane and Targeting Mitochondria in Breast Cancer Cells. Front Pharmacol. 2018; 9:1297. doi: 10.3389/fphar.2018.01297

Literature

Paper title : N-myristoylation of Antimicrobial Peptide CM4 Enhances Its Anticancer Activity by Interacting With Cell Membrane and Targeting Mitochondria in Breast Cancer Cells.

Doi : https://doi.org/10.3389/fphar.2018.01297

Abstract : Development of antimicrobial peptides (AMPs) as highly effective and selective anticancer agents would represent great progress in cancer treatment. Here we show that myristoyl-CM4, a new synthetic analog generated by N-myristoylation of AMPs CM4, had anticancer activity against MCF-7, MDA-MB-231, MX-1 breast cancer cells (IC<sub>50</sub> of 3-6 μM) and MDA-MB-231 xenograft tumors. The improved activity was attributed to the effect of myristoyl on the cell membrane. Flow cytometry and confocal laser scanning microscopy results showed that N-myristoylation significantly increased the membrane affinity toward breast cancer cells and also effectively mediated cellular entry. Despite increasing cytotoxicity against HEK293 and NIH3T3 cells and erythrocytes associated with its anticancer activity, myristoyl-CM4 maintained a certain selectivity toward breast cancer cells. Accordingly, the membrane affinity toward breast cancer cells was two to threefold higher than that of normal cells. Glycosylation analysis showed that sialic acid-containing oligosaccharides (including O-mucin and gangliosides) were important targets for myristoyl-CM4 binding to breast cancer cells. After internalization, co-localization analysis revealed that myristoyl-CM4 targeted mitochondria and induced mitochondrial dysfunction, including alterations in mitochondrial transmembrane potential, reactive oxygen species (ROS) generation and cytochrome c release. Activation of caspase 9, caspase 3 and cleavage of PARP were observed in MX-1, MCF-7, and MDA-MB-231 cells after myristoyl-CM4 treatment. The current work indicates that increasing hydrophobicity by myristoylation to modulate peptide-membrane interactions and then target mitochondria is a good strategy to develop AMPs as anticancer agents in the future.