dbacp08032
General Description
Peptide name : Peptide10 Gonearrestide
Source/Organism : Androctonus mauritanicus
Linear/Cyclic : Linear
Chirality : L
Sequence Information
Sequence : NDADKDEMQSVYRGKANDDNSRGSKTNHRF
Peptide length: 30
C-terminal modification: Linear
N-terminal modification : Free
Non-natural peptide information:
Activity Information
Assay type : MTT assay
Assay time : 24-h
Activity : Not Available
Cell line : U-251
Cancer type : Brain tumor
Other activity : Anticancer
Physicochemical Properties
Amino acid composition bar chart :
Molecular mass : 3456.5874 Dalton
Aliphatic index : 0.163
Instability index : 0.91
Hydrophobicity (GRAVY) : -1.986
Isoelectric point : 6.762
Charge (pH 7) : -0.1483
Aromaticity : 6.666
Molar extinction coefficient (cysteine, cystine): (0, 0)
Hydrophobic/hydrophilic ratio : 0.3043
hydrophobic moment : 0.087
Missing amino acid : C,I,L,P,W
Most occurring amino acid : D
Most occurring amino acid frequency : 5
Least occurring amino acid : E
Least occurring amino acid frequency : 1
Structural Information
3D structure :
Secondary structure fraction (Helix, Turn, Sheet): (23., 46., 13.)
SMILES Notation: CSCC[C@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](N)CC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1ccccc1)C(=O)O)[C@@H](C)O)C(C)C
Secondary Structure :
| Method | Prediction |
|---|---|
| GOR | CCHTHHHHHHHHTTCCCCTTTTTTTTTEEE |
| Chou-Fasman (CF) | HHHHHHHEEEECHHHHCCCCCCCCCCCCCC |
| Neural Network (NN) | CCCCCCHHHHHHCCCCCCCCCCCCCCCCCC |
| Joint/Consensus | CCCCHHHHHHHHCCCCCCCCCCCCCCCCCC |
Molecular Descriptors and ADMET Properties
Molecular Descriptors: Click here to download
ADMET Properties: Click here to download
Cross Referencing databases
CancerPPD : Not available
ApIAPDB : Not available
CancerPPD2 ID: 5943
Reference
1 : Li B, et al. Triggering of cancer cell cycle arrest by a novel scorpion venom-derived peptide-Gonearrestide. J Cell Mol Med. 2018; 22:4460-4473. doi: 10.1111/jcmm.13745
Literature
Paper title : Triggering of cancer cell cycle arrest by a novel scorpion venom-derived peptide-Gonearrestide.
Doi : https://doi.org/10.1111/jcmm.13745
Abstract : In this study, a novel scorpion venom-derived peptide named Gonearrestide was identified in an in-house constructed scorpion venom library through a combination of high-throughput NGS transcriptome and MS/MS proteome platform. In total, 238 novel peptides were discovered from two scorpion species; and 22 peptides were selected for further study after a battery of functional prediction analysis. Following a series of bioinformatics analysis alongside with in vitro biological functional screenings, Gonearrestide was found to be a highly potent anticancer peptide which acts on a broad spectrum of human cancer cells while causing few if any observed cytotoxic effects on epithelial cells and erythrocytes. We further investigated the precise anticancer mechanism of Gonearrestide by focusing on its effects on the colorectal cancer cell line, HCT116. NGS RNA sequencing was employed to obtain full gene expression profiles in HCT116 cells, cultured in the presence and absence of Gonearrestide, to dissect signalling pathway differences. Taken together the in vitro, in vivo and ex vivo validation studies, it was proven that Gonearrestide could inhibit the growth of primary colon cancer cells and solid tumours by triggering cell cycle arrest in G1 phase through inhibition of cyclin-dependent kinases 4 (CDK4) and up-regulate the expression of cell cycle regulators/inhibitors-cyclin D3, p27, and p21. Furthermore, prediction of signalling pathways and potential binding sites used by Gonearrestide are also presented in this study.