dbACP: A Comprehensive Database of Anti-Cancer Peptides

dbacp08077

General Description

Peptide name : PvD1

Source/Organism : Phaseolus vulgaris

Linear/Cyclic : Linear

Chirality : L

Sequence Information

Sequence : KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC

Peptide length: 47

C-terminal modification: Linear

N-terminal modification : Free

Non-natural peptide information:

Activity Information

Assay type : MTT assay

Assay time : 24-h

Activity : IC50 = 0.82 ± 0.14 µM

Cell line : MDA-MB-231

Cancer type : Breast Cancer

Other activity : Antimicrobial

Physicochemical Properties

Amino acid composition bar chart :

Molecular mass : 5448.0812 Dalton

Aliphatic index : 0.187

Instability index : 37.2383

Hydrophobicity (GRAVY) : -1.148

Isoelectric point : 8.1965

Charge (pH 7) : 1.8604

Aromaticity : 8.510

Molar extinction coefficient (cysteine, cystine): (8, 4)

Hydrophobic/hydrophilic ratio : 0.6207

hydrophobic moment : -0.441

Missing amino acid : I,M,Q,V

Most occurring amino acid : C

Most occurring amino acid frequency : 8

Least occurring amino acid : A

Least occurring amino acid frequency : 1

Structural Information

3D structure :

Secondary structure fraction (Helix, Turn, Sheet): (21., 29., 23.)

SMILES Notation: CC(C)C[C@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)[C@@H](N)CCCCN)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@H](C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CS)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@H](C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CS)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CS)C(=O)O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O

Secondary Structure :

Method Prediction
GOR TCHTTTTTTTTCCCEECTCCCTTTTTTTHHTTTTCCTTTTTTTTTTT
Chou-Fasman (CF) CCHHHHEEECCCEEEEECCHHHHHHHHHHCCCCHHHHHEEEECCCCC
Neural Network (NN) CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHCCCCC
Joint/Consensus CCCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC

Molecular Descriptors and ADMET Properties

Molecular Descriptors: Click here to download

ADMET Properties: Click here to download

Cross Referencing databases

Pubmed Id : 29076508.0

Uniprot : Not available

PDB : 6VPN

CancerPPD : Not available

ApIAPDB : Not available

CancerPPD2 ID: 5712

Reference

1 : Figueira TN, et al. Challenging metastatic breast cancer with the natural defensin PvD<sub>1</sub>. Nanoscale. 2017; 9:16887-16899. doi: 10.1039/c7nr05872a

Literature

Paper title : Challenging metastatic breast cancer with the natural defensin PvD<sub>1</sub>.

Doi : https://doi.org/10.1039/c7nr05872a

Abstract : Metastatic breast cancer is a very serious life threatening condition that poses many challenges for the pharmaceutical development of effective chemotherapeutics. As the therapeutics targeted to the localized masses in breast improve, metastatic lesions in the brain slowly increase in their incidence compromising successful treatment outcomes overall. The blood-brain-barrier (BBB) is one important obstacle for the management of breast cancer brain metastases. New therapeutic approaches are in demand for overcoming the BBB's breaching by breast tumor cells. In this work we demonstrate the potential dual role of a natural antimicrobial plant defensin, PvD<sub>1</sub>: it interferes with the formation of solid tumors in the breast and concomitantly controls adhesion of breast cancer cells to human brain endothelial cells. We have used a combination of techniques that probe PvD<sub>1</sub>'s effect at the single cell level and reveal that this peptide can effectively damage breast tumor cells, leaving healthy breast and brain cells unaffected. Results suggest that PvD1 quickly internalizes in cancer cells but remains located in the membrane of normal cells with no significant damage to its structure and biomechanical properties. These interactions in turn modulate cell adhesiveness between tumor and BBB cells. PvD<sub>1</sub> is a potential template for the design of innovative pharmacological approaches for metastatic breast cancer treatment: the manipulation of the biomechanical properties of tumor cells that ultimately prevent their attachment to the BBB.