dbacp08077
General Description
Peptide name : PvD1
Source/Organism : Phaseolus vulgaris
Linear/Cyclic : Linear
Chirality : L
Sequence Information
Sequence : KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC
Peptide length: 47
C-terminal modification: Linear
N-terminal modification : Free
Non-natural peptide information:
Activity Information
Assay type : MTT assay
Assay time : 24-h
Activity : IC50 = 0.82 ± 0.14 µM
Cell line : MDA-MB-231
Cancer type : Breast Cancer
Other activity : Antimicrobial
Physicochemical Properties
Amino acid composition bar chart :
Molecular mass : 5448.0812 Dalton
Aliphatic index : 0.187
Instability index : 37.2383
Hydrophobicity (GRAVY) : -1.148
Isoelectric point : 8.1965
Charge (pH 7) : 1.8604
Aromaticity : 8.510
Molar extinction coefficient (cysteine, cystine): (8, 4)
Hydrophobic/hydrophilic ratio : 0.6207
hydrophobic moment : -0.441
Missing amino acid : I,M,Q,V
Most occurring amino acid : C
Most occurring amino acid frequency : 8
Least occurring amino acid : A
Least occurring amino acid frequency : 1
Structural Information
3D structure :
Secondary structure fraction (Helix, Turn, Sheet): (21., 29., 23.)
SMILES Notation: CC(C)C[C@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)[C@@H](N)CCCCN)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@H](C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CS)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@H](C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CS)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CS)C(=O)O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O
Secondary Structure :
| Method | Prediction |
|---|---|
| GOR | TCHTTTTTTTTCCCEECTCCCTTTTTTTHHTTTTCCTTTTTTTTTTT |
| Chou-Fasman (CF) | CCHHHHEEECCCEEEEECCHHHHHHHHHHCCCCHHHHHEEEECCCCC |
| Neural Network (NN) | CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHCCCCC |
| Joint/Consensus | CCCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC |
Molecular Descriptors and ADMET Properties
Molecular Descriptors: Click here to download
ADMET Properties: Click here to download
Cross Referencing databases
CancerPPD : Not available
ApIAPDB : Not available
CancerPPD2 ID: 5712
Reference
1 : Figueira TN, et al. Challenging metastatic breast cancer with the natural defensin PvD<sub>1</sub>. Nanoscale. 2017; 9:16887-16899. doi: 10.1039/c7nr05872a
Literature
Paper title : Challenging metastatic breast cancer with the natural defensin PvD<sub>1</sub>.
Doi : https://doi.org/10.1039/c7nr05872a
Abstract : Metastatic breast cancer is a very serious life threatening condition that poses many challenges for the pharmaceutical development of effective chemotherapeutics. As the therapeutics targeted to the localized masses in breast improve, metastatic lesions in the brain slowly increase in their incidence compromising successful treatment outcomes overall. The blood-brain-barrier (BBB) is one important obstacle for the management of breast cancer brain metastases. New therapeutic approaches are in demand for overcoming the BBB's breaching by breast tumor cells. In this work we demonstrate the potential dual role of a natural antimicrobial plant defensin, PvD<sub>1</sub>: it interferes with the formation of solid tumors in the breast and concomitantly controls adhesion of breast cancer cells to human brain endothelial cells. We have used a combination of techniques that probe PvD<sub>1</sub>'s effect at the single cell level and reveal that this peptide can effectively damage breast tumor cells, leaving healthy breast and brain cells unaffected. Results suggest that PvD1 quickly internalizes in cancer cells but remains located in the membrane of normal cells with no significant damage to its structure and biomechanical properties. These interactions in turn modulate cell adhesiveness between tumor and BBB cells. PvD<sub>1</sub> is a potential template for the design of innovative pharmacological approaches for metastatic breast cancer treatment: the manipulation of the biomechanical properties of tumor cells that ultimately prevent their attachment to the BBB.