dbACP: A Comprehensive Database of Anti-Cancer Peptides

dbacp08080

General Description

Peptide name : APETx4

Source/Organism : Anthopleura elegantissima

Linear/Cyclic : Linear

Chirality : L

Sequence Information

Sequence : GTTCYCGKTIGIYWFGKYSCPTNRGYTGSCPYFLGICCYPVD

Peptide length: 42

C-terminal modification: Linear

N-terminal modification : Free

Non-natural peptide information:

Activity Information

Assay type : CellTox Green Dye assay

Assay time : 20-h

Activity : Green object count < 100 /mm2 at 20 μM

Cell line : MDA-MB-435S

Cancer type : Skin Cancer

Other activity : Anticancer

Physicochemical Properties

Amino acid composition bar chart :

Molecular mass : 4660.3299 Dalton

Aliphatic index : 0.440

Instability index : 14.1619

Hydrophobicity (GRAVY) : 0.0333

Isoelectric point : 8.293

Charge (pH 7) : 1.697

Aromaticity : 21.42

Molar extinction coefficient (cysteine, cystine): (6, 3)

Hydrophobic/hydrophilic ratio : 1.3333

hydrophobic moment : 0.4271

Missing amino acid : A,E,H,M,Q

Most occurring amino acid : G

Most occurring amino acid frequency : 7

Least occurring amino acid : W

Least occurring amino acid frequency : 1

Structural Information

3D structure :

Secondary structure fraction (Helix, Turn, Sheet): (7.1, 33., 45.)

SMILES Notation: CC[C@H](C)[C@H](NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CS)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CN)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)CC)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](Cc1ccccc1)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)N[C@@H](CC(=O)O)C(=O)O)C(C)C)[C@@H](C)CC)[C@@H](C)O)[C@@H](C)O

Secondary Structure :

Method Prediction
GOR TCEEETTTCCEEEEETTTTCTTCTTCCTCCCEEEEEECCCTC
Chou-Fasman (CF) EEEECEEEEEEEEEECCCCCCCCEEEECCEEEEEEEEEECCC
Neural Network (NN) CCEEECCCCCEEEEECCCCCCCCCCCCCCCCCCEEECCCCCC
Joint/Consensus CCEEECCCCCEEEEECCCCCCCCCCCCCCCCEEEEEECCCCC

Molecular Descriptors and ADMET Properties

Molecular Descriptors: Click here to download

ADMET Properties: Click here to download

Cross Referencing databases

Pubmed Id : 28902151.0

Uniprot : Not available

PDB : Not available

CancerPPD : Not available

ApIAPDB : Not available

CancerPPD2 ID: 5577

Reference

1 : Moreels L, et al. APETx4, a Novel Sea Anemone Toxin and a Modulator of the Cancer-Relevant Potassium Channel K<sub>V</sub>10.1. Mar Drugs. 2017; 15:(unknown pages). doi: 10.3390/md15090287

Literature

Paper title : APETx4, a Novel Sea Anemone Toxin and a Modulator of the Cancer-Relevant Potassium Channel K<sub>V</sub>10.1.

Doi : https://doi.org/10.3390/md15090287

Abstract : The human ether-à-go-go channel (hEag1 or K<sub>V</sub>10.1) is a cancer-relevant voltage-gated potassium channel that is overexpressed in a majority of human tumors. Peptides that are able to selectively inhibit this channel can be lead compounds in the search for new anticancer drugs. Here, we report the activity-guided purification and electrophysiological characterization of a novel K<sub>V</sub>10.1 inhibitor from the sea anemone Anthopleura elegantissima. Purified sea anemone fractions were screened for inhibitory activity on K<sub>V</sub>10.1 by measuring whole-cell currents as expressed in Xenopus laevis oocytes using the two-microelectrode voltage clamp technique. Fractions that showed activity on Kv10.1 were further purified by RP-HPLC. The amino acid sequence of the peptide was determined by a combination of MALDI- LIFT-TOF/TOF MS/MS and CID-ESI-FT-ICR MS/MS and showed a high similarity with APETx1 and APETx3 and was therefore named APETx4. Subsequently, the peptide was electrophysiologically characterized on K<sub>V</sub>10.1. The selectivity of the toxin was investigated on an array of voltage-gated ion channels, including the cardiac human ether-à-go-go-related gene potassium channel (hERG or Kv11.1). The toxin inhibits K<sub>V</sub>10.1 with an IC<sub>50</sub> value of 1.1 μM. In the presence of a similar toxin concentration, a shift of the activation curve towards more positive potentials was observed. Similar to the effect of the gating modifier toxin APETx1 on hERG, the inhibition of Kv10.1 by the isolated toxin is reduced at more positive voltages and the peptide seems to keep the channel in a closed state. Although the peptide also induces inhibitory effects on other K<sub>V</sub> and Na<sub>V</sub> channels, it exhibits no significant effect on hERG. Moreover, APETx4 induces a concentration-dependent cytotoxic and proapoptotic effect in various cancerous and noncancerous cell lines. This newly identified K<sub>V</sub>10.1 inhibitor can be used as a tool to further characterize the oncogenic channel K<sub>V</sub>10.1 or as a scaffold for the design and synthesis of more potent and safer anticancer drugs.