dbACP: A Comprehensive Database of Anti-Cancer Peptides

dbacp08140

General Description

Peptide name : Laterosporulin10 (LS10)

Source/Organism : Brevibacillus sp. strain SKDU10

Linear/Cyclic : Linear

Chirality : L

Sequence Information

Sequence : ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL

Peptide length: 52

C-terminal modification: Linear

N-terminal modification : Free

Non-natural peptide information:

Activity Information

Assay type : MTT assay

Assay time : 24-h

Activity : 20% cytotoxicity 5 μM concentration

Cell line : HeLa

Cancer type : Cervical Cancer

Other activity : Antimicrobial

Physicochemical Properties

Amino acid composition bar chart :

Molecular mass : 5881.7689 Dalton

Aliphatic index : 0.636

Instability index : 32.5596

Hydrophobicity (GRAVY) : -0.419

Isoelectric point : 8.2995

Charge (pH 7) : 1.9108

Aromaticity : 9.615

Molar extinction coefficient (cysteine, cystine): (6, 3)

Hydrophobic/hydrophilic ratio : 1.08

hydrophobic moment : -0.360

Missing amino acid : S,W

Most occurring amino acid : C

Most occurring amino acid frequency : 6

Least occurring amino acid : F

Least occurring amino acid frequency : 1

Structural Information

3D structure :

Secondary structure fraction (Helix, Turn, Sheet): (25., 23., 28.)

SMILES Notation: CC[C@H](C)[C@H](NC(=O)[C@H](C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CS)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CS)NC(=O)[C@H](C)N)C(C)C)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CS)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)NCC(=O)N[C@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)N[C@@H](CCC(=O)O)C(=O)NCC(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)O)[C@@H](C)O)C(C)C)C(C)C)C(C)C)C(C)C)[C@@H](C)CC

Secondary Structure :

Method Prediction
GOR EEETTCCCCHHHHHHTTTTTTTHHHHHTTEEEEEEETTTCEEEETTTCCCEE
Chou-Fasman (CF) EEECCCCCCEEEEECCCCCCHHHHEEEEEEEECCCCCCEEEECCCCCCCCCC
Neural Network (NN) CCCCCCCCCCCHHHHCCCCCCCCCCCCCCCEEEEHHCCCCCEECCCCCCCCC
Joint/Consensus EEECCCCCCCCHHHHCCCCCCCCCCCCCCEEEEECCCCCCEEECCCCCCCCC

Molecular Descriptors and ADMET Properties

Molecular Descriptors: Click here to download

ADMET Properties: Click here to download

Cross Referencing databases

Pubmed Id : 28422156.0

Uniprot : Not available

PDB : Not available

CancerPPD : Not available

ApIAPDB : Not available

CancerPPD2 ID: 5667

Reference

1 : Baindara P, et al. Anticancer properties of a defensin like class IId bacteriocin Laterosporulin10. Sci Rep. 2017; 7:46541. doi: 10.1038/srep46541

Literature

Paper title : Anticancer properties of a defensin like class IId bacteriocin Laterosporulin10.

Doi : https://doi.org/10.1038/srep46541

Abstract : Laterosporulin10 (LS10) is a defensin like peptide from Brevibacillus sp. strain SKDU10 that inhibited microbial pathogens. However, in this study, anticancer activity of LS10 was examined against different cancer cell lines and compared with normal cells. LS10 displayed cytotoxicity against cancer cells like MCF-7, HEK293T, HT1080, HeLa and H1299 at below 10 μM concentration, but not against prostate epithelium cells RWPE-1. Additionally, no hemolysis was observed at significantly higher concentration compared to IC<sub>50</sub> values observed for different cancer cell lines. Release of lactate dehydrogenase from cancer cell lines at 15 μM concentration upon 120 min treatment indicated the lytic ability of LS10. Accordingly, electron microscopy experiments also confirmed the necrotic effect of LS10 at 15 μM concentration against cancer cells. Furthermore, flow cytometry analysis of treated cancer cell lines revealed that LS10 induce apoptosis even at 2.5 μM concentration. Nevertheless, RWPE-1 cells remained viable even at 20 μM concentration. These results provide evidence that LS10 is an anticancer bacteriocin, which causes apoptotic and necrotic death of cancer cells at lower and higher concentrations, respectively. Taken all results together, the present study signifies that LS10 is an anticancer peptide that could be further developed for therapeutic applications.