dbACP: A Comprehensive Database of Anti-Cancer Peptides

6 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp05105 PA10 RQIKIWFQNRRMKWKKGGGGNNETTSIQIAGSLHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay 184B5 Breast cancer MIC : 10 μM
dbacp05109 PA15 RQIKIWFQNRRMKWKKGGSLSAACHEQWSLGAQHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay 184B5 Breast cancer MIC : 10 μM
dbacp05113 PA2 RQIKIWFQNRRMKWKKGGATRPRVDTQPELCGMHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay 184B5 Breast cancer MIC : 10 μM
dbacp05117 PA3 RQIKIWFQNRRMKWKKGGDCLCISRRARLLRATHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay 184B5 Breast cancer MIC : 10 μM
dbacp05121 PA38 RQIKIWFQNRRMKWKKGGKYNGRFTTHHLLHLLNHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay 184B5 Breast cancer MIC : 10 μM
dbacp05125 PA49 RQIKIWFQNRRMKWKKGGAGVYTFLVGADNRGWEHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay 184B5 Breast cancer MIC : 10 μM