dbACP: A Comprehensive Database of Anti-Cancer Peptides

10 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02326 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption WST-1 assay 486P Bladder cancer IC50 : 251.47 µg/ml
dbacp02330 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption Cell viability assay 486P Bladder cancer IC50 : 69.2 µg/ml
dbacp02334 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption LDH leakage assay 486P Bladder cancer IC50 : 373.3/ µg/ml
dbacp02345 Cecropin B KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL Chinese oak silk moth Membrane disruption WST-1 assay 486P Bladder cancer IC50 : 161.76 µg/ml
dbacp02349 Cecropin B KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL Chinese oak silk moth Membrane disruption Cell viability assay 486P Bladder cancer IC50 : 87.47 µg/ml
dbacp02353 Cecropin B KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL Chinese oak silk moth Membrane disruption LDH leakage assay 486P Bladder cancer IC50 : 232.4 µg/ml
dbacp04479 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS African clawed frog Membrane perforation LDH leakage assay 486P(G4) Bladder cancer IC50 : 28.6 µM
dbacp04482 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS African clawed frog Membrane perforation WST-1 assay 486P(G4) Bladder cancer IC50 : 57.8 µM
dbacp04485 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS African clawed frog Membrane perforation Cell viability assay 486P(G4) Bladder cancer IC50 : 59.4 µM
dbacp04497 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS Yunnan firebelly toad Membrane perforation Cell viability assay 486P(G4) Bladder cancer IC50 : 59.4 µM