dbACP: A Comprehensive Database of Anti-Cancer Peptides

5 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp05442 Peptide-20 CSSRTMHHC Synthetic Peptide Inducing apoptosis MTT/MTS assay A-2058 Skin cancer At100 µM 30% viablity
dbacp07242 RB4 MADSERLSAPGCWAACTNFSRTRK Derived from protein PLP2 F-actin modulation induces necrotic death. MTT assay A-2058 Skin Cancer EC50 = 0.744 ± 0.208 mol/L × 10-3
dbacp08319 Sample Peptide 2 from US011339203B2 FIGNLALSDLLAGVAYTANLLLKKRTLRKNDRKKR Synthetic Not Available CCK-8 assay A-2058 Skin Cancer Cell Viability = 0.2% at 25 μM
dbacp08330 Sample Peptide 1 from EP3604345B1 MQIPQAPWPVVWAVLQLGWRKKRTLRKNDRKKR Synthetic Not Available CCK-8 / WST-8 A-2058 Skin Cancer Cell Viability = 6.7% at 25 μM
dbacp08338 Sample Peptide 3 from EP3604345B1 MRIFAVFIFMTYWHLLNAKKRTLRKNDRKKR Synthetic Not Available CCK-8 / WST-8 A-2058 Skin Cancer Cell Viability = 87.5% at 25 μM