dbACP: A Comprehensive Database of Anti-Cancer Peptides

3 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp01377 Aurein-3.2 GLFDIVKKIAGHIASSI Southern bell frog Cell membrane disintegration One-dose and five-dose assay A498 Renal cancer IC50 : 5 μM
dbacp02084 Buforin Iib RAGLQFPVGRLLRRLLRRLLR Not found Inducing apoptosis MTT/MTS assay A498 Not specified IC50 : 10 µg/ml
dbacp05224 Penaeidin-2 YRGGYTGPIPRPPPIGRPPLPRVVCACYRLSVSDARNCCIKFGSCCHLVK Pacific white shrimp Induction of apoptosis MTT assay A498 Kidney cancer MIC : 100 μg/mL