3 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp01377 | Aurein-3.2 | GLFDIVKKIAGHIASSI | Southern bell frog | Cell membrane disintegration | One-dose and five-dose assay | A498 | Renal cancer | IC50 : 5 μM |
| dbacp02084 | Buforin Iib | RAGLQFPVGRLLRRLLRRLLR | Not found | Inducing apoptosis | MTT/MTS assay | A498 | Not specified | IC50 : 10 µg/ml |
| dbacp05224 | Penaeidin-2 | YRGGYTGPIPRPPPIGRPPLPRVVCACYRLSVSDARNCCIKFGSCCHLVK | Pacific white shrimp | Induction of apoptosis | MTT assay | A498 | Kidney cancer | MIC : 100 μg/mL |