5 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp01335 | Aurein-2.5 | GLFDIVKKVVGAFGSL | Green and golden bell frog | Cell membrane disintegration | One-dose and five-dose assay | ACHN | Renal cancer | IC50 : 5 μM |
| dbacp02027 | Buforin IIb | RAGLQFPVGRLLRRLLRRLLR | Histone H2A | Inducing mitochondria-dependent apoptosis | MTT/MTS assay | ACHN | Renal cancer | IC50 : 12 µg/ml |
| dbacp02085 | Buforin Iib | RAGLQFPVGRLLRRLLRRLLR | Not found | Inducing apoptosis | MTT/MTS assay | ACHN | Not specified | IC50 : 12 µg/ml |
| dbacp03033 | Gageostatin A | ELLVDLL | Bacillus subtilis | Perturbation of the cell membrane | Sulforhodamine B (SBR) assay | ACHN | Renal cancer | GI50 : 4.6–19.6 μg/mL |
| dbacp05223 | Penaeidin-2 | YRGGYTGPIPRPPPIGRPPLPRVVCACYRLSVSDARNCCIKFGSCCHLVK | Pacific white shrimp | Induction of apoptosis | MTT assay | ACHN | Kidney cancer | MIC : 100 μg/mL |