dbACP: A Comprehensive Database of Anti-Cancer Peptides

5 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp01335 Aurein-2.5 GLFDIVKKVVGAFGSL Green and golden bell frog Cell membrane disintegration One-dose and five-dose assay ACHN Renal cancer IC50 : 5 μM
dbacp02027 Buforin IIb RAGLQFPVGRLLRRLLRRLLR Histone H2A Inducing mitochondria-dependent apoptosis MTT/MTS assay ACHN Renal cancer IC50 : 12 µg/ml
dbacp02085 Buforin Iib RAGLQFPVGRLLRRLLRRLLR Not found Inducing apoptosis MTT/MTS assay ACHN Not specified IC50 : 12 µg/ml
dbacp03033 Gageostatin A ELLVDLL Bacillus subtilis Perturbation of the cell membrane Sulforhodamine B (SBR) assay ACHN Renal cancer GI50 : 4.6–19.6 μg/mL
dbacp05223 Penaeidin-2 YRGGYTGPIPRPPPIGRPPLPRVVCACYRLSVSDARNCCIKFGSCCHLVK Pacific white shrimp Induction of apoptosis MTT assay ACHN Kidney cancer MIC : 100 μg/mL