2 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp02723 | Dermaseptin-PS1 | ALWKTMLKKLGTVALHAGKAALGAVADTISQ | Rock Kribensis Cichlid | Disrupting cell membranes; Apoptosis | Lactate dehydrogenase (LDH) assay, MTT cell proliferation assay | U251MG | Human glioblastoma | MIC : 10−5 M and above |
| dbacp02724 | Dermaseptin-PS1 | ALWKTMLKKLGTVALHAGKAALGAVADTISQ | Skin, the waxy monkey tree frog, South America | Penetrating cell membrane | Not specified | Not found | Not found | Not found |