dbACP: A Comprehensive Database of Anti-Cancer Peptides

2 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02723 Dermaseptin-PS1 ALWKTMLKKLGTVALHAGKAALGAVADTISQ Rock Kribensis Cichlid Disrupting cell membranes; Apoptosis Lactate dehydrogenase (LDH) assay, MTT cell proliferation assay U251MG Human glioblastoma MIC : 10−5 M and above
dbacp02724 Dermaseptin-PS1 ALWKTMLKKLGTVALHAGKAALGAVADTISQ Skin, the waxy monkey tree frog, South America Penetrating cell membrane Not specified Not found Not found Not found