dbACP: A Comprehensive Database of Anti-Cancer Peptides

153 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp00001 Citropin modified peptide-3 GLFAVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 6 M
dbacp00002 Citropin modified peptide-3 GLFAVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Lung tumor cell line Lung cancer IC50 : 6 M
dbacp00003 Citropin modified peptide-3 GLFAVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Colon tumor cell line Colon cancer IC50 : 6 M
dbacp00004 Citropin modified peptide-3 GLFAVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Brain tumor cell line Brain tumor IC50 : 6 M
dbacp00005 Citropin modified peptide-3 GLFAVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Skin tumor cell line Skin cancer IC50 : 6 M
dbacp00006 Citropin modified peptide-3 GLFAVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Ovary tumor cell line Ovarian cancer IC50 : 6 M
dbacp00007 Citropin modified peptide-3 GLFAVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Liver tumor celline Liver cancer IC50 : 1 µM
dbacp00008 Citropin modified peptide-3 GLFAVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Prostate tumor cell line Prostate cancer IC50 : 6 M
dbacp00009 Citropin modified peptide-3 GLFAVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Breast tumor cell line Breast cancer IC50 : 6 M
dbacp00010 Citropin modified peptide-5 GLFDVIKAVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00011 Citropin modified peptide-5 GLFDVIKAVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Lung tumor cell line Lung cancer IC50 : 5 M
dbacp00012 Citropin modified peptide-5 GLFDVIKAVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Colon tumor cell line Colon cancer IC50 : 5 M
dbacp00013 Citropin modified peptide-5 GLFDVIKAVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Brain tumor cell line Brain tumor IC50 : 5 M
dbacp00014 Citropin modified peptide-5 GLFDVIKAVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Skin tumor cell line Skin cancer IC50 : 100 µM
dbacp00015 Citropin modified peptide-5 GLFDVIKAVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Ovary tumor cell line Ovarian cancer IC50 : 5 M
dbacp00016 Citropin modified peptide-5 GLFDVIKAVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Liver tumor celline Liver cancer IC50 : 100 µM
dbacp00017 Citropin modified peptide-5 GLFDVIKAVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Prostate tumor cell line Prostate cancer IC50 : 5 M
dbacp00018 Citropin modified peptide-5 GLFDVIKAVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Breast tumor cell line Breast cancer IC50 : 5 M
dbacp00019 Citropin modified peptide-7 GLFDVIKKVAAVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00020 Citropin modified peptide-7 GLFDVIKKVAAVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Lung tumor cell line Lung cancer IC50 : 5 M
dbacp00021 Citropin modified peptide-7 GLFDVIKKVAAVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Colon tumor cell line Colon cancer IC50 : 5 M
dbacp00022 Citropin modified peptide-7 GLFDVIKKVAAVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Brain tumor cell line Brain tumor IC50 : 5 M
dbacp00023 Citropin modified peptide-7 GLFDVIKKVAAVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Skin tumor cell line Skin cancer IC50 : 5 M
dbacp00024 Citropin modified peptide-7 GLFDVIKKVAAVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Ovary tumor cell line Ovarian cancer IC50 : 5 M
dbacp00025 Citropin modified peptide-7 GLFDVIKKVAAVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Liver tumor celline Liver cancer IC50 : 5 M
dbacp00026 Citropin modified peptide-7 GLFDVIKKVAAVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Prostate tumor cell line Prostate cancer IC50 : 5 M
dbacp00027 Citropin modified peptide-7 GLFDVIKKVAAVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Breast tumor cell line Breast cancer IC50 : 5 M
dbacp00098 Citropin modified peptide-11 GLFDVIKKVASVIKGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00099 Citropin modified peptide-11 GLFDVIKKVASVIKGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Lung tumor cell line Lung cancer IC50 : 5 M
dbacp00100 Citropin modified peptide-11 GLFDVIKKVASVIKGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Colon tumor cell line Colon cancer IC50 : 5 M
dbacp00101 Citropin modified peptide-11 GLFDVIKKVASVIKGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Brain tumor cell line Brain tumor IC50 : 5 M
dbacp00102 Citropin modified peptide-11 GLFDVIKKVASVIKGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Skin tumor cell line Skin cancer IC50 : 5 M
dbacp00103 Citropin modified peptide-11 GLFDVIKKVASVIKGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Ovary tumor cell line Ovarian cancer IC50 : 5 M
dbacp00104 Citropin modified peptide-11 GLFDVIKKVASVIKGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Liver tumor celline Liver cancer IC50 : 5 M
dbacp00105 Citropin modified peptide-11 GLFDVIKKVASVIKGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Prostate tumor cell line Prostate cancer IC50 : 5 M
dbacp00106 Citropin modified peptide-11 GLFDVIKKVASVIKGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Breast tumor cell line Breast cancer IC50 : 5 M
dbacp00107 Citropin modified peptide-13 GLFDVIKKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00108 Citropin modified peptide-13 GLFDVIKKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Lung tumor cell line Lung cancer IC50 : 5 M
dbacp00109 Citropin modified peptide-13 GLFDVIKKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Colon tumor cell line Colon cancer IC50 : 5 M
dbacp00110 Citropin modified peptide-13 GLFDVIKKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Brain tumor cell line Brain tumor IC50 : 5 M
dbacp00111 Citropin modified peptide-13 GLFDVIKKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Skin tumor cell line Skin cancer IC50 : 5 M
dbacp00112 Citropin modified peptide-13 GLFDVIKKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Ovary tumor cell line Ovarian cancer IC50 : 5 M
dbacp00113 Citropin modified peptide-13 GLFDVIKKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Liver tumor celline Liver cancer IC50 : 5 M
dbacp00114 Citropin modified peptide-13 GLFDVIKKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Prostate tumor cell line Prostate cancer IC50 : 5 M
dbacp00115 Citropin modified peptide-13 GLFDVIKKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Breast tumor cell line Breast cancer IC50 : 5 M
dbacp00116 Citropin modified peptide-14 GLFDVIAKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00117 Citropin modified peptide-14 GLFDVIAKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Lung tumor cell line Lung cancer IC50 : 5 M
dbacp00118 Citropin modified peptide-14 GLFDVIAKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Colon tumor cell line Colon cancer IC50 : 5 M
dbacp00119 Citropin modified peptide-14 GLFDVIAKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Brain tumor cell line Brain tumor IC50 : 5 M
dbacp00120 Citropin modified peptide-14 GLFDVIAKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Skin tumor cell line Skin cancer IC50 : 5 M
dbacp00121 Citropin modified peptide-14 GLFDVIAKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Ovary tumor cell line Ovarian cancer IC50 : 5 M
dbacp00122 Citropin modified peptide-14 GLFDVIAKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Liver tumor celline Liver cancer IC50 : 5 M
dbacp00123 Citropin modified peptide-14 GLFDVIAKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Prostate tumor cell line Prostate cancer IC50 : 5 M
dbacp00124 Citropin modified peptide-14 GLFDVIAKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Breast tumor cell line Breast cancer IC50 : 5 M
dbacp00150 Citropin modified peptide-15 GLFAVIKKVASVIKGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00151 Citropin modified peptide-15 GLFAVIKKVASVIKGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Lung tumor cell line Lung cancer IC50 : 5 M
dbacp00152 Citropin modified peptide-15 GLFAVIKKVASVIKGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Colon tumor cell line Colon cancer IC50 : 5 M
dbacp00153 Citropin modified peptide-15 GLFAVIKKVASVIKGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Brain tumor cell line Brain tumor IC50 : 5 M
dbacp00154 Citropin modified peptide-15 GLFAVIKKVASVIKGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Skin tumor cell line Skin cancer IC50 : 5 M
dbacp00155 Citropin modified peptide-15 GLFAVIKKVASVIKGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Ovary tumor cell line Ovarian cancer IC50 : 5 M
dbacp00156 Citropin modified peptide-15 GLFAVIKKVASVIKGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Liver tumor celline Liver cancer IC50 : 5 M
dbacp00157 Citropin modified peptide-15 GLFAVIKKVASVIKGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Prostate tumor cell line Prostate cancer IC50 : 5 M
dbacp00158 Citropin modified peptide-15 GLFAVIKKVASVIKGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Breast tumor cell line Breast cancer IC50 : 5 M
dbacp00183 Citropin modified peptide-16 GLFAVIKKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00184 Citropin modified peptide-16 GLFAVIKKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Lung tumor cell line Lung cancer IC50 : 5 M
dbacp00185 Citropin modified peptide-16 GLFAVIKKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Colon tumor cell line Colon cancer IC50 : 5 M
dbacp00186 Citropin modified peptide-16 GLFAVIKKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Brain tumor cell line Brain tumor IC50 : 5 M
dbacp00187 Citropin modified peptide-16 GLFAVIKKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Skin tumor cell line Skin cancer IC50 : 5 M
dbacp00188 Citropin modified peptide-16 GLFAVIKKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Ovary tumor cell line Ovarian cancer IC50 : 5 M
dbacp00189 Citropin modified peptide-16 GLFAVIKKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Liver tumor celline Liver cancer IC50 : 5 M
dbacp00190 Citropin modified peptide-16 GLFAVIKKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Prostate tumor cell line Prostate cancer IC50 : 5 M
dbacp00191 Citropin modified peptide-16 GLFAVIKKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Breast tumor cell line Breast cancer IC50 : 5 M
dbacp00217 Citropin modified peptide-17 GLFAVIKKVAAVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00218 Citropin modified peptide-17 GLFAVIKKVAAVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Lung tumor cell line Lung cancer IC50 : 5 M
dbacp00219 Citropin modified peptide-17 GLFAVIKKVAAVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Colon tumor cell line Colon cancer IC50 : 5 M
dbacp00220 Citropin modified peptide-17 GLFAVIKKVAAVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Brain tumor cell line Brain tumor IC50 : 5 M
dbacp00221 Citropin modified peptide-17 GLFAVIKKVAAVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Skin tumor cell line Skin cancer IC50 : 5 M
dbacp00222 Citropin modified peptide-17 GLFAVIKKVAAVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Ovary tumor cell line Ovarian cancer IC50 : 5 M
dbacp00223 Citropin modified peptide-17 GLFAVIKKVAAVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Liver tumor celline Liver cancer IC50 : 5 M
dbacp00224 Citropin modified peptide-17 GLFAVIKKVAAVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Prostate tumor cell line Prostate cancer IC50 : 5 M
dbacp00225 Citropin modified peptide-17 GLFAVIKKVAAVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Breast tumor cell line Breast cancer IC50 : 5 M
dbacp00252 Citropin modified peptide-18 GLFAVIKKVAAVIRRL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00253 Citropin modified peptide-18 GLFAVIKKVAAVIRRL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Lung tumor cell line Lung cancer IC50 : 5 M
dbacp00254 Citropin modified peptide-18 GLFAVIKKVAAVIRRL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Colon tumor cell line Colon cancer IC50 : 5 M
dbacp00255 Citropin modified peptide-18 GLFAVIKKVAAVIRRL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Brain tumor cell line Brain tumor IC50 : 5 M
dbacp00256 Citropin modified peptide-18 GLFAVIKKVAAVIRRL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Skin tumor cell line Skin cancer IC50 : 5 M
dbacp00257 Citropin modified peptide-18 GLFAVIKKVAAVIRRL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Ovary tumor cell line Ovarian cancer IC50 : 5 M
dbacp00258 Citropin modified peptide-18 GLFAVIKKVAAVIRRL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Liver tumor celline Liver cancer IC50 : >10 µM
dbacp00259 Citropin modified peptide-18 GLFAVIKKVAAVIRRL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Prostate tumor cell line Prostate cancer IC50 : 5 M
dbacp00260 Citropin modified peptide-18 GLFAVIKKVAAVIRRL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Breast tumor cell line Breast cancer IC50 : 5 M
dbacp00261 Citropin modified peptide-19 GLFAVIKKVAKVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00262 Citropin modified peptide-19 GLFAVIKKVAKVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Lung tumor cell line Lung cancer IC50 : 6 M
dbacp00263 Citropin modified peptide-19 GLFAVIKKVAKVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Colon tumor cell line Colon cancer IC50 : 5 M
dbacp00264 Citropin modified peptide-19 GLFAVIKKVAKVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Brain tumor cell line Brain tumor IC50 : 5 M
dbacp00265 Citropin modified peptide-19 GLFAVIKKVAKVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Skin tumor cell line Skin cancer IC50 : 5 M
dbacp00266 Citropin modified peptide-19 GLFAVIKKVAKVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Ovary tumor cell line Ovarian cancer IC50 : 5 M
dbacp00267 Citropin modified peptide-19 GLFAVIKKVAKVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Liver tumor celline Liver cancer IC50 : 5 M
dbacp00268 Citropin modified peptide-19 GLFAVIKKVAKVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Prostate tumor cell line Prostate cancer IC50 : 5 M
dbacp00269 Citropin modified peptide-19 GLFAVIKKVAKVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Breast tumor cell line Breast cancer IC50 : 5 M
dbacp00270 Citropin modified peptide-22 GLFKVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00271 Citropin modified peptide-22 GLFKVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Lung tumor cell line Lung cancer IC50 : 5 M
dbacp00272 Citropin modified peptide-22 GLFKVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Colon tumor cell line Colon cancer IC50 : 5 M
dbacp00273 Citropin modified peptide-22 GLFKVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Brain tumor cell line Brain tumor IC50 : 5 M
dbacp00274 Citropin modified peptide-22 GLFKVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Skin tumor cell line Skin cancer IC50 : 5 M
dbacp00275 Citropin modified peptide-22 GLFKVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Ovary tumor cell line Ovarian cancer IC50 : 5 M
dbacp00276 Citropin modified peptide-22 GLFKVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Liver tumor celline Liver cancer IC50 : >10 µM
dbacp00277 Citropin modified peptide-22 GLFKVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Prostate tumor cell line Prostate cancer IC50 : >10 µM
dbacp00278 Citropin modified peptide-22 GLFKVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Breast tumor cell line Breast cancer IC50 : 5 M
dbacp00292 Citropin modified peptide-23 GLFKVIKKVAKVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00293 Citropin modified peptide-23 GLFKVIKKVAKVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Lung tumor cell line Lung cancer IC50 : 5 M
dbacp00294 Citropin modified peptide-23 GLFKVIKKVAKVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Colon tumor cell line Colon cancer IC50 : 5 M
dbacp00295 Citropin modified peptide-23 GLFKVIKKVAKVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Brain tumor cell line Brain tumor IC50 : 5 M
dbacp00296 Citropin modified peptide-23 GLFKVIKKVAKVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Skin tumor cell line Skin cancer IC50 : 5 M
dbacp00297 Citropin modified peptide-23 GLFKVIKKVAKVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Ovary tumor cell line Ovarian cancer IC50 : 5 M
dbacp00298 Citropin modified peptide-23 GLFKVIKKVAKVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Liver tumor celline Liver cancer IC50 : >10 µM
dbacp00299 Citropin modified peptide-23 GLFKVIKKVAKVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Prostate tumor cell line Prostate cancer IC50 : 5 M
dbacp00300 Citropin modified peptide-23 GLFKVIKKVAKVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Breast tumor cell line Breast cancer IC50 : 5 M
dbacp02315 Cationic Amphiphilic GIIKKIIIKKI AMP Membrane disruption WST-1 assay HeLa Cervical cancer IC50 : 160 µM
dbacp02316 Cationic Amphiphilic GIIKKIIIKKIIIKKI AMP Membrane disruption WST-1 assay HeLa Cervical cancer IC50 : 15 µM
dbacp02317 Cationic Amphiphilic GIIKKIIIKKIIIKKIIIKKI AMP Membrane disruption WST-1 assay HeLa Pancreatic cancer IC50 : 4 µM
dbacp02318 Cationic Amphiphilic GIIKKIIIKKI AMP Membrane disruption WST-1 assay HL-60 Pancreatic cancer IC50 : >500 µM
dbacp02319 Cationic Amphiphilic GIIKKIIIKKIIIKKI AMP Membrane disruption WST-1 assay HL-60 Pancreatic cancer IC50 : 25 µM
dbacp02320 Cationic Amphiphilic GIIKKIIIKKIIIKKIIIKKI AMP Membrane disruption WST-1 assay HL-60 Pancreatic cancer IC50 : 10 µM
dbacp02488 Citropin 1.1 GLFDVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp02489 Citropin 1.1 GLFDVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Lung tumor cell line Lung cancer IC50 : 5 M
dbacp02490 Citropin 1.1 GLFDVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Colon tumor cell line Colon cancer IC50 : 5 M
dbacp02491 Citropin 1.1 GLFDVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Brain tumor cell line Brain tumor IC50 : 5 M
dbacp02492 Citropin 1.1 GLFDVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Skin tumor cell line Skin cancer IC50 : 5 M
dbacp02493 Citropin 1.1 GLFDVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Ovary tumor cell line Ovarian cancer IC50 : 5 M
dbacp02494 Citropin 1.1 GLFDVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Liver tumor celline Liver cancer IC50 : 5 M
dbacp02495 Citropin 1.1 GLFDVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Prostate tumor cell line Prostate cancer IC50 : 5 M
dbacp02496 Citropin 1.1 GLFDVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Breast tumor cell line Breast cancer IC50 : 5 M
dbacp02499 Citropin 1.1D glfdvikkvasviggl Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp02500 Citropin 1.1D glfdvikkvasviggl Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Lung tumor cell line Lung cancer IC50 : 5 M
dbacp02501 Citropin 1.1D glfdvikkvasviggl Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Colon tumor cell line Colon cancer IC50 : 5 M
dbacp02502 Citropin 1.1D glfdvikkvasviggl Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Brain tumor cell line Brain tumor IC50 : 5 M
dbacp02503 Citropin 1.1D glfdvikkvasviggl Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Skin tumor cell line Skin cancer IC50 : 5 M
dbacp02504 Citropin 1.1D glfdvikkvasviggl Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Ovary tumor cell line Ovarian cancer IC50 : 5 M
dbacp02505 Citropin 1.1D glfdvikkvasviggl Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Liver tumor celline Liver cancer IC50 : 5 M
dbacp02506 Citropin 1.1D glfdvikkvasviggl Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Prostate tumor cell line Prostate cancer IC50 : 5 M
dbacp02507 Citropin 1.1D glfdvikkvasviggl Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Breast tumor cell line Breast cancer IC50 : 5 M
dbacp02647 Demegen P-113 AKRHHGYKRKFH Amphibian skin peptide Disruption of electric potential of the cell membrane; Necrosis; Membranolytic activity leading to apoptosis MTT/MTS assay U-937 Lymphoma cancer 15% Cytotoxicity at 0.5 µg/ml
dbacp03427 Interferon gamma (IFN-gamma) MKYTSYFLALLLCVLLGFSGSYGQGQFFREIENLKEYFNASNPDVAKGGPLFSEILKNWKDESDKKIIQSQIVSFYFKLFENLKDNQIIQRSMDIIKQnMFQKFLNGSSEKLEDFKKLIQIPVDDLQTQRKAINELIKVMNDLSPKSNLRKRKRSQNLFRGRRASM Swamp type water buffalo Immunomodulatory activity Not specified Not found Not found Not found
dbacp03468 Interferon gamma (IFN-gamma) MKYTSYFLALLLCVLLGFSGSYGQGQFFREIENLKEYFNASNPDVAKGGPLFSEILKNWKDESDKKIIQSQIVSFYFKLFENLKDNQIIQRSMDIIKQDMFQKFLNGSSEKLEDFKKLIQIPVDDLQTQRKAINELIKVMNDLSPKSNLRKRKRSQNLFRGRRASM Domestic water buffalo x Swamp type water buffalo (Hybrid buffalo) Not specified Not specified Not found Not found Not found
dbacp05934 Retro LGGIVSAVKKIVDFLG Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp05935 Retro LGGIVSAVKKIVDFLG Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Lung tumor cell line Lung cancer IC50 : 5 M
dbacp05936 Retro LGGIVSAVKKIVDFLG Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Colon tumor cell line Colon cancer IC50 : >10 µM
dbacp05937 Retro LGGIVSAVKKIVDFLG Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Brain tumor cell line Brain tumor IC50 : 5 M
dbacp05938 Retro LGGIVSAVKKIVDFLG Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Skin tumor cell line Skin cancer IC50 : 5 M
dbacp05939 Retro LGGIVSAVKKIVDFLG Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Ovary tumor cell line Ovarian cancer IC50 : 5 M
dbacp05940 Retro LGGIVSAVKKIVDFLG Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Liver tumor celline Liver cancer IC50 : >10 µM
dbacp05941 Retro LGGIVSAVKKIVDFLG Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Prostate tumor cell line Prostate cancer IC50 : >10 µM
dbacp05942 Retro LGGIVSAVKKIVDFLG Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Breast tumor cell line Breast cancer IC50 : >10 µM