dbACP: A Comprehensive Database of Anti-Cancer Peptides

6 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp06494 Vibi E GIPCAESCVWIPCTVTALIGCGCSNKVCYN Alpine violet, Viola biflora Cell membrane disintegration Not specified Not found Leukemia cancer Not found
dbacp06495 Vibi E GIPCAESCVWIPCTVTALIGCGCSNKVCYN Alpine violet, Viola biflora Cell membrane disintegration Not specified Not found Lung cancer Not found
dbacp06496 Vibi G GTFPCGESCVFIPCLTSAIGCSCKSKVCYKN Alpine violet, Viola biflora Cell membrane disintegration Not specified Not found Skin cancer Not found
dbacp06497 Vibi G GTFPCGESCVFIPCLTSAIGCSCKSKVCYKN Alpine violet, Viola biflora Cell membrane disintegration Not specified Not found Lung cancer Not found
dbacp06498 Vibi H GLLPCAESCVYIPCLTTVIGCSCKSKVCYKN Alpine violet, Viola biflora Cell membrane disintegration Not specified Not found Lung cancer Not found
dbacp06499 Vibi H GLLPCAESCVYIPCLTTVIGCSCKSKVCYKN Alpine violet, Viola biflora Cell membrane disintegration Not specified Not found Lung cancer Not found