5 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp05131 | Palustrin-Ca | MFTLKKSLLLLFFLGTISLSLCEQERDADGDEGEVEEVKRGFLDIIKDTGKEFAVKILNNLKCKLAGGCPP | American bullfrog | Not specified | Not specified | Not found | Not found | Not found |
| dbacp05132 | Palustrin-Ca | MFTLKKSLLLLFFLGTISLSLCEQERDADGDEGEVEEVKRGFLDIIKDTGKEFAVKILNNLKCKLAGGCPP | American bullfrog | Membrane disruption | Not specified | Not found | Not found | Not found |
| dbacp05133 | Palustrin-Ca | GFLDIIKDTGKEFAVKILNNLKCKLAGGCPP | Skin, the American bullfrog, North America | Not specified | Quantitative assays | Not found | Not found | Not found |
| dbacp05243 | Pentadactylin | GLLDTLKGAAKNVVGSLASKVMEKL | South American bullfrog, skin secretion, Leptodactylus labyrinthicus | Cell membrane disintegration | Not specified | Not found | Not found | Not found |
| dbacp06256 | Temporin-La | LLRHVVKILEKYL | Skin,the American bullfrog, North America | Not specified | Quantitative assays | Not found | Not found | Not found |