39 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp04826 | neo-N-methylSansalvamide A | NA | Marine fungus | Apoptosis induction | Not specified | MES-SA | Uterus cancer | 1.00 ± 0.20 nM/L |
| dbacp04827 | neo-N-methylSansalvamide A | NA | Marine fungus | Apoptosis induction | Not specified | HCT15 | Colon cancer | 0.85 ± 0.63 nM/L |
| dbacp06022 | San A-amide | NA | Marine fungus, Wilt of banana | Apoptosis induction | Not specified | HCT-116 | Colon cancer | MIC : 0.98 µg/mL |
| dbacp07287 | P264-G274 | PARDVLNTTSG | Parasporin-2Aa1 | h-APN receptor–mediated apoptosis induction. | Sulforhodamine B assay | SW-480 | Colorectal Cancer | EC50 = 90.98 ± 0.75 µM |
| dbacp07288 | P264-G274 | PARDVLNTTSG | Parasporin-2Aa1 | h-APN receptor–mediated apoptosis induction. | Sulforhodamine B assay | SW-620 | Colorectal Cancer | EC50 = 11.28 ± 0.52 µM |
| dbacp07289 | Loop1-PS2Aa | NNETYFNAVKP | Parasporin-2Aa1 | h-APN receptor–mediated apoptosis induction. | Sulforhodamine B assay | SW-480 | Colorectal Cancer | EC50 = 23.76 ± 1.25 µM |
| dbacp07290 | Loop1-PS2Aa | NNETYFNAVKP | Parasporin-2Aa1 | h-APN receptor–mediated apoptosis induction. | Sulforhodamine B assay | SW-620 | Colorectal Cancer | EC50 = 106.2 ± 1.67 µM |
| dbacp07291 | Loop2-PS2Aa | TYFNAVKPPITA | Parasporin-2Aa1 | h-APN receptor–mediated apoptosis induction. | Sulforhodamine B assay | SW-480 | Colorectal Cancer | EC50 = 92.99 ± 0.98 µM |
| dbacp07292 | Loop2-PS2Aa | TYFNAVKPPITA | Parasporin-2Aa1 | h-APN receptor–mediated apoptosis induction. | Sulforhodamine B assay | SW-620 | Colorectal Cancer | EC50 = 15.95 ± 0.69 µM |
| dbacp07293 | Loop1-HCoV-229E | FKPQSGGGKCF | Alphacoronavirus (HCoV-229E) | h-APN receptor–mediated apoptosis induction. | Sulforhodamine B assay | SW-480 | Colorectal Cancer | EC50 = 125.0 ± 1.32 µM |
| dbacp07294 | A4W-GGN5 | FLGWLFKVASK | Gaegurin 5 | h-APN receptor–mediated apoptosis induction. | Sulforhodamine B assay | SW-480 | Colorectal Cancer | EC50 = 98.63 ± 1.17 µM |
| dbacp07295 | A4W-GGN5 | FLGWLFKVASK | Gaegurin 5 | h-APN receptor–mediated apoptosis induction. | Sulforhodamine B assay | SW-620 | Colorectal Cancer | EC50 = 22.07 ± 1.63 µM |
| dbacp07309 | LyeTxI-b | IWLTALKFLGKNLGKLAKQQLAKL | Synthetic | Apoptosis induction and immune modulation. | MTT assay | 4T1 | Breast Cancer | IC50 = 6.5 ± 5.30 µM |
| dbacp07310 | LyeTxI-b | IWLTALKFLGKNLGKLAKQQLAKL | Synthetic | Apoptosis induction and immune modulation. | MTT assay | MCF-7 | Breast Cancer | IC50 = 7.34 ± 3.09 µM |
| dbacp07311 | LyeTxI-b | IWLTALKFLGKNLGKLAKQQLAKL | Synthetic | Apoptosis induction and immune modulation. | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 5.77 ± 0.83 µM |
| dbacp07347 | GA - 2 | Structure given in figure | Synthetic (glycyrrhetinic acid (GA)-based peptides) | Apoptosis induction, Bax/p53/caspase activation | MTT assay | MCF-7 | Breast Cancer | IC50 = 7.70 ± 1.3 µg/mL |
| dbacp07348 | GA - 2 | Structure given in figure | Synthetic (glycyrrhetinic acid (GA)-based peptides) | Apoptosis induction, Bax/p53/caspase activation | MTT assay | HCT-116 | Colon Cancer | IC50 = 70.30 ± 0.9 µg/mL |
| dbacp07349 | GA - 3 | Structure given in figure | Synthetic (glycyrrhetinic acid (GA)-based peptides) | Apoptosis induction, Bax/p53/caspase activation | MTT assay | MCF-7 | Breast Cancer | IC50 = 5.1 ± 0.7 µg/mL |
| dbacp07350 | GA - 3 | Structure given in figure | Synthetic (glycyrrhetinic acid (GA)-based peptides) | Apoptosis induction, Bax/p53/caspase activation | MTT assay | HCT-116 | Colon Cancer | IC50 = 7.40 ± 0.4 µg/mL |
| dbacp07351 | GA - 4 | Structure given in figure | Synthetic (glycyrrhetinic acid (GA)-based peptides) | Apoptosis induction, Bax/p53/caspase activation | MTT assay | MCF-7 | Breast Cancer | IC50 = 6.10 ± 0.4 µg/mL |
| dbacp07352 | GA - 4 | Structure given in figure | Synthetic (glycyrrhetinic acid (GA)-based peptides) | Apoptosis induction, Bax/p53/caspase activation | MTT assay | HCT-116 | Colon Cancer | IC50 = 73.0 ± 1.4 µg/mL |
| dbacp07353 | GA - 5 | Structure given in figure | Synthetic (glycyrrhetinic acid (GA)-based peptides) | Apoptosis induction, Bax/p53/caspase activation | MTT assay | MCF-7 | Breast Cancer | IC50 = 5.0 ± 0.3 µg/mL |
| dbacp07354 | GA - 5 | Structure given in figure | Synthetic (glycyrrhetinic acid (GA)-based peptides) | Apoptosis induction, Bax/p53/caspase activation | MTT assay | HCT-116 | Colon Cancer | IC50 = 5.2 ± 0.8 µg/mL |
| dbacp07355 | GA - 7 | Structure given in figure | Synthetic (glycyrrhetinic acid (GA)-based peptides) | Apoptosis induction, Bax/p53/caspase activation | MTT assay | MCF-7 | Breast Cancer | IC50 = 3.70 ± 0.2 µg/mL |
| dbacp07356 | GA - 7 | Structure given in figure | Synthetic (glycyrrhetinic acid (GA)-based peptides) | Apoptosis induction, Bax/p53/caspase activation | MTT assay | HCT-116 | Colon Cancer | IC50 = 3.0 ± 1.1 µg/mL |
| dbacp07357 | GA - 7 | Structure given in figure | Synthetic (glycyrrhetinic acid (GA)-based peptides) | Apoptosis induction, Bax/p53/caspase activation | MTT assay | HepG-2 | Liver Cancer | IC50 = 3.30 ± 0.1 µg/mL |
| dbacp07358 | GA - 8 | Structure given in figure | Synthetic (glycyrrhetinic acid (GA)-based peptides) | Apoptosis induction, Bax/p53/caspase activation | MTT assay | MCF-7 | Breast Cancer | IC50 = 6.90 ± 1.1 µg/mL |
| dbacp07359 | GA - 8 | Structure given in figure | Synthetic (glycyrrhetinic acid (GA)-based peptides) | Apoptosis induction, Bax/p53/caspase activation | MTT assay | HCT-116 | Colon Cancer | IC50 = 60.70 ± 0.6 µg/mL |
| dbacp07373 | HPRP-A1 | FKKLKKLFSKLWNWK | N-terminal region of Helicobacter pylori ribosomal protein L1 | Apoptosis induction, p53-mediated cell cycle arrest | MTT assay | CT-26 | Colorectal Cancer | IC50 between 0.5 and 1 µg/mL |
| dbacp07374 | HPRP-A1 | FKKLKKLFSKLWNWK | N-terminal region of Helicobacter pylori ribosomal protein L1 | Apoptosis induction, p53-mediated cell cycle arrest | MTT assay | HT-29 | Colon Cancer | IC50 ~ 0.5 µg/mL |
| dbacp07859 | HN-1 | FALGAVTKLLPSLLCMITRKC | Amolops hainanensis | Apoptosis induction and immune activation | MTT assay | MCF-7 | Breast Cancer | IC50 = 6.9 μM |
| dbacp07860 | HN-1 | FALGAVTKLLPSLLCMITRKC | Amolops hainanensis | Apoptosis induction and immune activation | MTT assay | A-549 | Lung Cancer | Not Available |
| dbacp07861 | HN-1 | FALGAVTKLLPSLLCMITRKC | Amolops hainanensis | Apoptosis induction and immune activation | MTT assay | SGC-7901 | Stomach Cancer | Not Available |
| dbacp07862 | HN-1 | FALGAVTKLLPSLLCMITRKC | Amolops hainanensis | Apoptosis induction and immune activation | MTT assay | MDA-MB-453 | Breast Cancer | Not Available |
| dbacp07863 | HN-1 | FALGAVTKLLPSLLCMITRKC | Amolops hainanensis | Apoptosis induction and immune activation | MTT assay | PC-3 | Prostate Cancer | Not Available |
| dbacp07864 | HN-1 | FALGAVTKLLPSLLCMITRKC | Amolops hainanensis | Apoptosis induction and immune activation | MTT assay | 4T1 | Breast Cancer | Not Available |
| dbacp07879 | Nubein6.8 | LKCNQLIPPFWKTCPKGKNLCYKMTMRAAPMVPVKRGCIDVCPKSSLLIKYMCCNTDKCN | Naja nubiae | DNA damage and apoptosis induction | MTT assay | A-375 | Skin Cancer | EC50 = 0.54 ± 0.04 μM |
| dbacp07880 | Nubein6.8 | LKCNQLIPPFWKTCPKGKNLCYKMTMRAAPMVPVKRGCIDVCPKSSLLIKYMCCNTDKCN | Naja nubiae | DNA damage and apoptosis induction | MTT assay | A-2780 | Ovarian Cancer | EC50 = 1.249 ± 0.06 μM |
| dbacp07881 | Nubein6.8 | LKCNQLIPPFWKTCPKGKNLCYKMTMRAAPMVPVKRGCIDVCPKSSLLIKYMCCNTDKCN | Naja nubiae | DNA damage and apoptosis induction | MTT assay | PANC-1 | Pancreatic Cancer | slight toxicity above 3.7 μM |