dbACP: A Comprehensive Database of Anti-Cancer Peptides

39 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp04826 neo-N-methylSansalvamide A NA Marine fungus Apoptosis induction Not specified MES-SA Uterus cancer 1.00 ± 0.20 nM/L
dbacp04827 neo-N-methylSansalvamide A NA Marine fungus Apoptosis induction Not specified HCT15 Colon cancer 0.85 ± 0.63 nM/L
dbacp06022 San A-amide NA Marine fungus, Wilt of banana Apoptosis induction Not specified HCT-116 Colon cancer MIC : 0.98 µg/mL
dbacp07287 P264-G274 PARDVLNTTSG Parasporin-2Aa1 h-APN receptor–mediated apoptosis induction. Sulforhodamine B assay SW-480 Colorectal Cancer EC50 = 90.98 ± 0.75 µM
dbacp07288 P264-G274 PARDVLNTTSG Parasporin-2Aa1 h-APN receptor–mediated apoptosis induction. Sulforhodamine B assay SW-620 Colorectal Cancer EC50 = 11.28 ± 0.52 µM
dbacp07289 Loop1-PS2Aa NNETYFNAVKP Parasporin-2Aa1 h-APN receptor–mediated apoptosis induction. Sulforhodamine B assay SW-480 Colorectal Cancer EC50 = 23.76 ± 1.25 µM
dbacp07290 Loop1-PS2Aa NNETYFNAVKP Parasporin-2Aa1 h-APN receptor–mediated apoptosis induction. Sulforhodamine B assay SW-620 Colorectal Cancer EC50 = 106.2 ± 1.67 µM
dbacp07291 Loop2-PS2Aa TYFNAVKPPITA Parasporin-2Aa1 h-APN receptor–mediated apoptosis induction. Sulforhodamine B assay SW-480 Colorectal Cancer EC50 = 92.99 ± 0.98 µM
dbacp07292 Loop2-PS2Aa TYFNAVKPPITA Parasporin-2Aa1 h-APN receptor–mediated apoptosis induction. Sulforhodamine B assay SW-620 Colorectal Cancer EC50 = 15.95 ± 0.69 µM
dbacp07293 Loop1-HCoV-229E FKPQSGGGKCF Alphacoronavirus (HCoV-229E) h-APN receptor–mediated apoptosis induction. Sulforhodamine B assay SW-480 Colorectal Cancer EC50 = 125.0 ± 1.32 µM
dbacp07294 A4W-GGN5 FLGWLFKVASK Gaegurin 5 h-APN receptor–mediated apoptosis induction. Sulforhodamine B assay SW-480 Colorectal Cancer EC50 = 98.63 ± 1.17 µM
dbacp07295 A4W-GGN5 FLGWLFKVASK Gaegurin 5 h-APN receptor–mediated apoptosis induction. Sulforhodamine B assay SW-620 Colorectal Cancer EC50 = 22.07 ± 1.63 µM
dbacp07309 LyeTxI-b IWLTALKFLGKNLGKLAKQQLAKL Synthetic Apoptosis induction and immune modulation. MTT assay 4T1 Breast Cancer IC50 = 6.5 ± 5.30 µM
dbacp07310 LyeTxI-b IWLTALKFLGKNLGKLAKQQLAKL Synthetic Apoptosis induction and immune modulation. MTT assay MCF-7 Breast Cancer IC50 = 7.34 ± 3.09 µM
dbacp07311 LyeTxI-b IWLTALKFLGKNLGKLAKQQLAKL Synthetic Apoptosis induction and immune modulation. MTT assay MDA-MB-231 Breast Cancer IC50 = 5.77 ± 0.83 µM
dbacp07347 GA - 2 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay MCF-7 Breast Cancer IC50 = 7.70 ± 1.3 µg/mL
dbacp07348 GA - 2 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay HCT-116 Colon Cancer IC50 = 70.30 ± 0.9 µg/mL
dbacp07349 GA - 3 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay MCF-7 Breast Cancer IC50 = 5.1 ± 0.7 µg/mL
dbacp07350 GA - 3 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay HCT-116 Colon Cancer IC50 = 7.40 ± 0.4 µg/mL
dbacp07351 GA - 4 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay MCF-7 Breast Cancer IC50 = 6.10 ± 0.4 µg/mL
dbacp07352 GA - 4 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay HCT-116 Colon Cancer IC50 = 73.0 ± 1.4 µg/mL
dbacp07353 GA - 5 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay MCF-7 Breast Cancer IC50 = 5.0 ± 0.3 µg/mL
dbacp07354 GA - 5 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay HCT-116 Colon Cancer IC50 = 5.2 ± 0.8 µg/mL
dbacp07355 GA - 7 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay MCF-7 Breast Cancer IC50 = 3.70 ± 0.2 µg/mL
dbacp07356 GA - 7 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay HCT-116 Colon Cancer IC50 = 3.0 ± 1.1 µg/mL
dbacp07357 GA - 7 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay HepG-2 Liver Cancer IC50 = 3.30 ± 0.1 µg/mL
dbacp07358 GA - 8 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay MCF-7 Breast Cancer IC50 = 6.90 ± 1.1 µg/mL
dbacp07359 GA - 8 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay HCT-116 Colon Cancer IC50 = 60.70 ± 0.6 µg/mL
dbacp07373 HPRP-A1 FKKLKKLFSKLWNWK N-terminal region of Helicobacter pylori ribosomal protein L1 Apoptosis induction, p53-mediated cell cycle arrest MTT assay CT-26 Colorectal Cancer IC50 between 0.5 and 1 µg/mL
dbacp07374 HPRP-A1 FKKLKKLFSKLWNWK N-terminal region of Helicobacter pylori ribosomal protein L1 Apoptosis induction, p53-mediated cell cycle arrest MTT assay HT-29 Colon Cancer IC50 ~ 0.5 µg/mL
dbacp07859 HN-1 FALGAVTKLLPSLLCMITRKC Amolops hainanensis Apoptosis induction and immune activation MTT assay MCF-7 Breast Cancer IC50 = 6.9 μM
dbacp07860 HN-1 FALGAVTKLLPSLLCMITRKC Amolops hainanensis Apoptosis induction and immune activation MTT assay A-549 Lung Cancer Not Available
dbacp07861 HN-1 FALGAVTKLLPSLLCMITRKC Amolops hainanensis Apoptosis induction and immune activation MTT assay SGC-7901 Stomach Cancer Not Available
dbacp07862 HN-1 FALGAVTKLLPSLLCMITRKC Amolops hainanensis Apoptosis induction and immune activation MTT assay MDA-MB-453 Breast Cancer Not Available
dbacp07863 HN-1 FALGAVTKLLPSLLCMITRKC Amolops hainanensis Apoptosis induction and immune activation MTT assay PC-3 Prostate Cancer Not Available
dbacp07864 HN-1 FALGAVTKLLPSLLCMITRKC Amolops hainanensis Apoptosis induction and immune activation MTT assay 4T1 Breast Cancer Not Available
dbacp07879 Nubein6.8 LKCNQLIPPFWKTCPKGKNLCYKMTMRAAPMVPVKRGCIDVCPKSSLLIKYMCCNTDKCN Naja nubiae DNA damage and apoptosis induction MTT assay A-375 Skin Cancer EC50 = 0.54 ± 0.04 μM
dbacp07880 Nubein6.8 LKCNQLIPPFWKTCPKGKNLCYKMTMRAAPMVPVKRGCIDVCPKSSLLIKYMCCNTDKCN Naja nubiae DNA damage and apoptosis induction MTT assay A-2780 Ovarian Cancer EC50 = 1.249 ± 0.06 μM
dbacp07881 Nubein6.8 LKCNQLIPPFWKTCPKGKNLCYKMTMRAAPMVPVKRGCIDVCPKSSLLIKYMCCNTDKCN Naja nubiae DNA damage and apoptosis induction MTT assay PANC-1 Pancreatic Cancer slight toxicity above 3.7 μM