dbACP: A Comprehensive Database of Anti-Cancer Peptides

3 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02358 Cecropin B KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL Silkmoth Pore formation at the cytoplasmic membrane MTT/MTS assay BTS-30 Breast cancer IC50 : 24.8 µM
dbacp02372 Cecropin P1 SWLSKTAKKLENSAKKRISEGIAIAIQGGPR Small Intestine of Pig Pore formation at the cytoplasmic membrane MTT/MTS assay BTS-30 Breast cancer IC50 : >100 µM
dbacp06076 Shiva-1 MPRWRLFRRIDRVGKQIKQGILRAGPAIALVGDARAVG African clawed frog Pore formation at the cytoplasmic membrane MTT/MTS assay BTS-30 Breast cancer IC50 : 56 µM