dbACP: A Comprehensive Database of Anti-Cancer Peptides

2 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp05791 Pyrularia thionin KSCCRNTWARNCYNVCRLPGTISREICAKKCDCKIISGTTCPSDYPK Buffalo nut Cell membrane disintegration Not specified Not found Colorectal cancer Not found
dbacp05792 Pyrularia thionin KSCCRNTWARNCYNVCRLPGTISREICAKKCDCKIISGTTCPSDYPK Buffalo nut Cell membrane disintegration Not specified Not found Colorectal cancer Not found