dbACP: A Comprehensive Database of Anti-Cancer Peptides

2 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp04626 MBD-2 CHTNGGYCVRAICPPSARRPGSCFPEKNPCCKYM Rat Not specified Not specified Not found Not found Not found
dbacp04627 MBD-2 (Murine beta-defensin 2a) CHTNGGYCVRAICPPSARRPGSCFPEKNPCCKYM Rat Not specified Not specified Not found Not found Not found