dbACP: A Comprehensive Database of Anti-Cancer Peptides

11 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp01172 Antp-LP4 RQIKIWFQNRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Apoptosis inducing Not specified CLL Leukemia IC50 : 0.7 ± 0.1 µM
dbacp01841 BIRD-2 (Bcl-2 IP3R disrupter 2) RKKRRQRRRGGNVYTEIKCNSLLPLAAIVRV Not found Inducing apoptosis MTT assay CLL Leukemia Not found
dbacp02618 D-Antp-LP4 RQIKIWFQNRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK Not found Inducing apoptosis Not specified CLL Leukemia IC50 : 0.7 ± 0.4 µM
dbacp02623 D-MinAntp-LP4 KRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK Not found Inducing apoptosis Not specified CLL Leukemia IC50 : 0.6 ± 0.2 µM
dbacp02625 D-N-Ter-Antp MAVPPTYADLGKSARDVFTKGYGFGLRQIKIWFQNRRMKWKK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified CLL Leukemia IC50 : 1.5 ± 0.6 µM
dbacp03471 IP3R-derived peptide (IDP) NVYTEIKCNSLLPLDDIVRV Not found Inducing apoptosis Not specified CLL Leukemia Not found
dbacp04287 LP-4 peptide SWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified CLL Leukemia Not found
dbacp04683 Min-Antp-LP4 KRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified CLL Leukemia IC50 : 0.3 ± 0.1 µM
dbacp04791 N-Ter-Antp N-Ter-RQIKIWFQNRRMKWKK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified CLL Leukemia IC50 : 3.2 ± 0.5 µM
dbacp06301 Tf-D-LP4 HAIYPRHSWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified CLL Leukemia IC50 : 1.2 ± 0.1 µM
dbacp06303 Tf-LP4 HAIYPRHSWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified CLL Leukemia IC50 : 1.7 ± 0.2 µM