12 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp01295 | Aurein-1.3 | GLFDIIKKIAESF | Southern bell frog | Cell membrane disintegration | One-dose and five-dose assay | SF-539 | CNS cancer | IC50 : 5 μM |
| dbacp01314 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Not specified | Not specified | Not found | CNS | Not found |
| dbacp01323 | Aurein-2.5 | GLFDIVKKVVGAFGSL | Green and golden bell frog | Not specified | Not specified | Not found | CNS | Not found |
| dbacp01332 | Aurein-2.5 | GLFDIVKKVVGAFGSL | Green and golden bell frog | Cell membrane disintegration | One-dose and five-dose assay | SNB-19 | CNS cancer | IC50 : 5 μM |
| dbacp01350 | Aurein-2.7 | GLFDIAKKVIGVIGSL | Southern bell frog | Cell membrane disintegration | One-dose and five-dose assay | SF-295 | CNS cancer | IC50 : 5 μM |
| dbacp01361 | Aurein-3.1 [Cleaved into: Aurein-3.1.1; Aurein-3.1.2] | GLFDIVKKIAGHIAGSI | Southern bell frog | Cell membrane disintegration | One-dose and five-dose assay | U251 | CNS cancer | IC50 : 5 μM |
| dbacp01374 | Aurein-3.2 | GLFDIVKKIAGHIASSI | Southern bell frog | Cell membrane disintegration | One-dose and five-dose assay | SNB-75 | CNS cancer | IC50 : 5 μM |
| dbacp01386 | Aurein-3.3 [Cleaved into: Aurein-3.3.1] | GLFDIVKKIAGHIVSSI | Southern bell frog | Cell membrane disintegration | One-dose and five-dose assay | SF-268 | CNS cancer | IC50 : 5 μM |
| dbacp04447 | Maculatin 1.3 | GLLGLLGSVVSHVVPAIVGHF | Fringed Tree Frog, Australia | Disruption of cancer membrane integrity | Not specified | Not specified | CNS | MIC : 1 – 100 µg/ml |
| dbacp04457 | Maculatin 1.4 | GLLGLLGSVVSHVLPAITQHL | Fringed Tree Frog, Australia | Disruption of cancer cell membrane integrity | Not specified | Not specified | CNS | MIC : 1 – 100 µg/ml |
| dbacp04466 | Maculatin 1.4 | GLLGLLGSVVSHVLPAITQHL | Fringed Tree Frog, Australia | Disruption of cancer cell membrane integrity | Not specified | Not specified | CNS | IC50 : 10−5 - 10−6 M |
| dbacp06609 | Maculatin 1.3 | GLLGLLGSVVSHVVPAIVGHF | Fringed Tree Frog, Australia | Disruption of either cancer or bacterial cell membrane integrity | Not specified | Not specified | CNS | IC50 : 10−5 to 10−6 M |